CAZyme Information: AN3441-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN3441-T-p1
• CAZy Family: GH18
• CAZyme Description: Trehalose 6-phosphate phosphatase, predicted subunit of the trehalose-6-phosphate synthase/phosphatase complex

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
908		102215.14	6.2712

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrVI_A_nidulans_FGSC_A4:708988-711836(+)

Full Sequence      

MSLQQDPSKPDGRPGEVRFDSFTDASAPNVSSNFNNASKTASALSEADKGTQSGSDLLHR
LSLKEILTMRAPDFQKQYQGLNLSGRIISAAFCIPHKLYFRAGRDWELKPRPGSSALFDS
FAYLASEKSGWSHTLVGWTGEVEPLNEGSNPLQALNSNANTNLPAALDNTSRSLSKGSAP
VVPDISLLQSNSSVAETSTVGPDDRKRLEDQLSSSRHGKVVPVWLSDESDVPEDTIILGD
QSRWRRYAEKELYALLHYKQNGPTDGRFERDSWTDYVRMNQLFAERILQEYKEGDIVWIH
DYHLFLLPSILRQHVPNIYIGFYLHSPFPSSEYMRCLAKRKEILTGVLGANMIGFQTFSY
SRHFSSCCTRVLGFESDSAGVDAYGAHVAVDVFPIGIDAEAIQKIAFENADTEKAVEGLR
QLYAGKKIIVGRDRLDSARGVAQKLQAFETFLERFPEWRDKVVLIQVTSPTSVEEEKEEQ
KIASRISNLVSTINGRFGSLSFSPVKYYPQYLSPHEYFALLRVADVGLITTVRDGMNTTS
LEYILCQQENHSPLILSEFSGTAGALSSAIHINPWDTIGVSEAINKALTESVADKKEQHL
KLYKHVTTNTVSAWSNQFISRLLANLSSFDQSMATPALDRTKLLKQYRKSRKRLFMFDYD
GTLTPIVKDPQSAIPSDRVLRTLKTLAADPRNAVWIISGRDQAFLDEWMGHIPELGLSAE
HGCFIRMPRSDNWQNLAETTDMGWQKEVMEIYQHFTERTQGSFIERKKVALTWHYRRADP
EYGAFQARECRKQLEEHVSKTWDVEVMAGKANLEVRPRFVNKGFIATRLVQAYEDGKVPE
FILCSGDDFTDEDMFRALKKFELPGDHVYTVTVGASSKQTEASWHLLEPSDVIETITMLN
NSASGQDY

Enzyme Prediction     

EC	3.1.3.12:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	84	622	1.8e-155	0.9705263157894737

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340820	GT20_TPS	0.0	194	622	46	462	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
184712	PRK14501	0.0	201	892	57	716	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
395781	Glyco_transf_20	5.88e-176	220	622	75	468	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
215556	PLN03064	9.16e-155	202	906	147	853	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
223457	OtsA	1.48e-154	199	622	67	477	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAO72737.1|GT20	0.0	1	854	1	854
BCS23255.1|GT20	0.0	1	908	1	910
QMW46130.1|GT20	0.0	22	908	60	945
QMW34075.1|GT20	0.0	22	908	60	945
UDD62950.1|GT20	0.0	22	908	60	945

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DXN_A	5.39e-166	633	901	1	271	Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 2 [Aspergillus fumigatus Af293],5DXO_A Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 3 [Aspergillus fumigatus Af293],5DXO_B Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 3 [Aspergillus fumigatus Af293]
5DXL_A	2.14e-159	635	902	3	272	Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 1 [Aspergillus fumigatus Af293]
5DXF_A	2.16e-149	76	625	19	526	Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314],5DXF_B Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314]
5DXI_A	1.43e-96	635	899	5	297	Structure of C. albicans Trehalose-6-phosphate phosphatase C-terminal domain [Candida albicans SC5314],5DXI_B Structure of C. albicans Trehalose-6-phosphate phosphatase C-terminal domain [Candida albicans SC5314]
5HVM_A	5.13e-95	202	622	71	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P31688|TPS2_YEAST	4.14e-232	86	904	15	851	Trehalose-phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS2 PE=1 SV=3
sp|P78875|TPP1_SCHPO	6.13e-219	76	901	28	814	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tpp1 PE=1 SV=2
sp|Q9P4D3|TPS2_ZYGRO	2.70e-216	86	904	10	858	Trehalose-phosphatase OS=Zygosaccharomyces rouxii OX=4956 GN=TPS2 PE=1 SV=1
sp|O14145|TPS2_SCHPO	9.66e-173	104	896	35	846	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tps2 PE=3 SV=1
sp|Q54NU9|TPSB_DICDI	1.94e-168	241	900	136	785	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] B OS=Dictyostelium discoideum OX=44689 GN=tpsB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000034	0.000000

TMHMM  Annotations     

There is no transmembrane helices in AN3441-T-p1.