CAZyme Information: AN3390-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN3390-T-p1
• CAZy Family: GH18
• CAZyme Description: Putative pectinesterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
325	ChrVI_A_nidulans_FGSC_A4|CGC15	34858.78	4.4994

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrVI_A_nidulans_FGSC_A4:864710-865863(-)

Full Sequence      

MRVQSYLSLFSLVGAALCAPREHFKRTARTSAPAGCLTVGGSGTYSTIGAAFAALGSSSS
EACIYISAGTYKEQLTFQYAGPLTLYGETTDTSSYKKNTVTITHTISSPEAGSLVASATV
NAAMDNFTMYNINVVNGYGKGAQAVALAASGERQGYYGCQFLGYQDTLYARVGVQYYSNC
YIEGAVDYIFGDASAWFGECDIVSNGAGYITAMSRETASDPAWYCFDHCNIYGKSGLDLT
GDVYLGRPWRVLARVIYQNSELSDIINAAGWTTMAEGATPLYYEIGNTGDGADTSKRLYL
SEISAAVTKATVLGSDWTDWLDWSY

Enzyme Prediction     

EC	3.1.1.11:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	40	303	3.4e-81	0.9166666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395871	Pectinesterase	7.51e-52	41	297	8	271	Pectinesterase.
215357	PLN02665	1.21e-45	41	297	76	333	pectinesterase family protein
178051	PLN02432	4.42e-45	41	317	19	291	putative pectinesterase
178372	PLN02773	4.63e-44	31	298	1	276	pectinesterase
178113	PLN02497	9.47e-44	41	298	40	300	probable pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABF50865.1|CE8|3.1.1.11	5.98e-238	1	325	1	325
EAA63358.1|CE8|3.1.1.11	5.98e-238	1	325	1	325
BCS19730.1|CE8	4.16e-169	1	325	1	324
AKH40276.1|CE8	7.09e-161	1	325	1	325
ALI87001.1|CE8|3.1.1.11	1.78e-159	7	325	8	327

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	1.37e-155	29	325	3	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	1.94e-155	29	325	3	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1XG2_A	6.92e-28	41	298	11	275	Chain A, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	1.83e-25	41	298	15	279	Pectin methylesterase from Carrot [Daucus carota]
2NSP_A	8.23e-17	44	318	17	338	Chain A, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B7U0|PMEA_EMENI	1.06e-238	1	325	1	325	Pectinesterase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pmeA PE=1 SV=1
sp|A2QK82|PMEA_ASPNC	8.59e-158	8	325	9	327	Probable pectinesterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pmeA PE=3 SV=1
sp|Q4WBT5|PMEA_ASPFU	4.45e-157	9	325	7	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	4.45e-157	9	325	7	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|A1DBT4|PMEA_NEOFI	1.27e-156	7	325	8	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000318	0.999634	CS pos: 18-19. Pr: 0.9742

TMHMM  Annotations     

There is no transmembrane helices in AN3390-T-p1.