CAZyme Information: AN3389-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN3389-T-p1
• CAZy Family: GH18
• CAZyme Description: Putative xylogalacturonan hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
400	ChrVI_A_nidulans_FGSC_A4|CGC9	41551.93	4.3004

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrVI_A_nidulans_FGSC_A4:866687-867953(+)

Full Sequence      

MTFGKAAFLSFSLFGASWAGPSRTLQARAVCTPKAGGSSSIDDVPAIVKSISACGDGGTI
VFPEDSTYYLNSVLDLAGCSGCELQVEGLLKFASDTDYWNGRTAMINVKNIDGLTIRSLT
GSGVIDGNGQNAYDRFAEDSSYDRPTPLYITGGGDIKVSNFRLKNAPNVFVSVKGGTTNA
VFSDMRLDATSKSENLPKNTDGFDIGESTYVTISGTTVSNNDDCVAFKPGCNYLTVTDIT
CTGSHGLSVGSLGKSSDDIVQNVRVEGATMISSTKAAGIKTYPSGGDHGLSTVTNVTWKD
ITIQNCDYAIQIQSCYGEDEEYCETNPGDAVFSGIAFEGFSGTTSSKYDPVTGNLNCGED
GKCDVSVVDYSVKAPSGGGKVLCANTPSSLGISCSSGASG

Enzyme Prediction     

EC	3.2.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	53	386	1.3e-65	0.9569230769230769

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	5.24e-45	80	394	24	321	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
177865	PLN02218	3.70e-30	23	385	63	417	polygalacturonase ADPG
215540	PLN03010	3.72e-30	35	385	54	388	polygalacturonase
178580	PLN03003	4.84e-24	5	381	4	367	Probable polygalacturonase At3g15720
215426	PLN02793	4.14e-21	60	347	88	371	Probable polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA63357.1|GH28	5.31e-281	1	378	1	378
BCS19729.1|GH28	7.56e-217	21	400	41	420
CAC07733.1|GH28|3.2.1.-	3.02e-201	21	400	27	406
CAB65657.1|GH28|3.2.1.-	3.02e-201	21	400	27	406
ABD61571.1|GH28	4.98e-200	1	400	1	406

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C2L_A	5.43e-203	21	400	9	388	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]
1NHC_A	1.73e-35	49	394	13	336	Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_B Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_C Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_D Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_E Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_F Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger]
6KVE_A	7.22e-32	25	394	5	344	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
7E56_A	8.59e-32	38	394	2	336	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
6KVH_A	1.91e-31	25	394	5	344	Chain A, endo-polygalacturonase [Evansstolkia leycettana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B7U1|XGHA_EMENI	9.43e-282	1	378	1	378	Probable endo-xylogalacturonan hydrolase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xghA PE=3 SV=1
sp|Q9UUZ2|XGHA_ASPTU	5.37e-202	21	400	27	406	Endo-xylogalacturonan hydrolase A OS=Aspergillus tubingensis OX=5068 GN=xghA PE=1 SV=1
sp|A2QK83|XGHA_ASPNC	8.84e-201	1	400	1	406	Probable endo-xylogalacturonan hydrolase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=xghA PE=3 SV=1
sp|B8NPS8|XGHA_ASPFN	7.23e-200	12	400	11	406	Probable endo-xylogalacturonan hydrolase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=xghA PE=3 SV=1
sp|Q2UBD8|XGHA_ASPOR	1.19e-198	12	400	11	406	Probable endo-xylogalacturonan hydrolase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=xghA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000356	0.999615	CS pos: 19-20. Pr: 0.9837

TMHMM  Annotations     

There is no transmembrane helices in AN3389-T-p1.