CAZyme Information: AN3337-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN3337-T-p1
• CAZy Family: GH17
• CAZyme Description: Protein with pectate lyase activity, involved in degradation of pectin

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
254	ChrVI_A_nidulans_FGSC_A4|CGC6	27014.56	8.4792

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrVI_A_nidulans_FGSC_A4:1055127-1055947(+)

Full Sequence      

MYQPLLLLPLLLTSAFANPHDPHIHHSLEKRASFPIPSSKGSVTFSSPKTISGTFDGGMK
TYGRGVKCTGQDEGGDEDAVFILKDGATLKNAIIGADQIEGVHCEGSCTIENVWWTDVCE
DALSLKGSGSGTHKIIGGGARNADDKVIQHNSGGKVIIQDFTVQNFGKLYRACGNCKKQF
KRTVKISGVKASSGKALVGINSNYGDTASIKGCATSVKEICVEYEGTNNNSKEPKKKSSG
PSSYCKYSEPLSKC

Enzyme Prediction     

EC	4.2.2.2:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	39	226	1e-78	0.9948453608247423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397360	Pectate_lyase	4.86e-115	33	231	1	200	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABF50862.1|PL3_2|4.2.2.2	7.82e-187	1	254	1	254
EAA63305.1|PL3_2|4.2.2.2	7.82e-187	1	254	1	254
QRD92807.1|PL3_2	1.94e-142	1	254	1	257
QMW36211.1|PL3_2	1.94e-142	1	254	1	257
BAE66524.1|PL3_2	1.94e-142	1	254	1	257

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EE6_A	2.49e-25	54	174	16	135	Crystal Structure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
4EW9_A	3.52e-24	54	215	21	182	The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]
3T9G_A	3.60e-24	54	215	22	183	The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii],3T9G_B The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii]
4Z03_A	3.26e-23	54	215	30	191	C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725],4Z03_B C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725]
4Z05_A	3.26e-23	54	215	30	191	C. bescii Family 3 pectate lyase mutant E84A [Caldicellulosiruptor bescii DSM 6725],4Z05_B C. bescii Family 3 pectate lyase mutant E84A [Caldicellulosiruptor bescii DSM 6725]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B7Z3|PLYE_EMENI	1.39e-187	1	254	1	254	Pectate lyase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyE PE=1 SV=1
sp|A1DBJ7|PLYE_NEOFI	2.62e-167	1	254	1	254	Probable pectate lyase E OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyE PE=3 SV=1
sp|B0Y9M8|PLYE_ASPFC	1.07e-166	1	254	1	254	Probable pectate lyase E OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyE PE=3 SV=1
sp|Q4WC29|PLYE_ASPFU	1.07e-166	1	254	1	254	Probable pectate lyase E OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyE PE=3 SV=1
sp|A1C4B8|PLYE_ASPCL	2.79e-146	1	254	1	254	Probable pectate lyase E OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=plyE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000274	0.999703	CS pos: 17-18. Pr: 0.9784

TMHMM  Annotations     

There is no transmembrane helices in AN3337-T-p1.