CAZyme Information: AN3229-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN3229-T-p1
• CAZy Family: GH16
• CAZyme Description: Putative aryl-alcohol oxidase-related protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
611	ChrVI_A_nidulans_FGSC_A4|CGC21	65609.56	4.6916

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrVI_A_nidulans_FGSC_A4:1400278-1402216(+)

Full Sequence      

MRHTALLPLVSSFIVPALAQIPGQTTVNATVNQGRFGNATYDYVIVGGGTSGLAIAARLA
EDPSLSVAVIEAGGYYELDGTVASIIPGLAAGANVGTDATEYSTVDWNFQAQPLTSANDR
SLRYNRGKTLGGSSARHYMVYQRGTRGSYDQWAELTGDESWGWDSVFPYFQRSVNVTPAN
MTGRFPNTTVTYDPSGFNKAGGPLHVTWPNYGSPWSTWIEQGLEAIGILPDTDFNTGTLN
GSSWAPITINPLSQKRDSSETSFLQQSLKTTNLTVYLHTMALKIGFDGTTASSVDVRSPV
GRFTLSARREIIVSAGALQSPQLLMVSGIGPRETLERHGIPVVKELAGVGQKMWEHPFFG
ITHQVNLVTATELAINQQALLQALNQYKSQQGPLTSAGFGVLGWEKLPNSTLSDSTNEAL
ATFPSDWPTIEYLSIDGYLNGWHSAADQATGNGQQWGTIAVALVAPLSRGNVTISSSDMD
DPPVFDLGFLTHPADREIAVAAMRRIRQAFAAISEITIGDEVVPGADVSTDEELLDFIRE
SIVPVYHVAGTCAMGREDDPEAVVDPQARVIGVNNLRVVDASIFPTLPPGHPQSTCYMVA
EKIADLIKKGN

Enzyme Prediction     

No EC number prediction in AN3229-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	40	609	1.4e-182	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	5.11e-112	40	608	5	532	choline dehydrogenase; Validated
225186	BetA	1.51e-98	38	609	5	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	3.52e-47	466	603	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.29e-39	37	599	52	568	Protein HOTHEAD
366272	GMC_oxred_N	1.17e-25	114	333	11	206	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA63130.1|AA3_2	0.0	1	611	1	611
EAA59311.1|AA3_2	4.75e-259	40	611	32	607
BCS27384.1|AA3_2	1.20e-254	40	611	32	607
QSZ37525.1|AA3_2	3.98e-178	17	610	9	610
UCK58435.1|AA3_2	1.99e-174	1	611	1	616

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	3.64e-65	41	608	2	562	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	7.19e-65	39	608	1	563	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	6.70e-63	38	609	3	584	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6O9N_A	5.64e-58	41	607	36	638	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
3NNE_A	2.36e-57	41	608	14	527	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B8A1|PKFF_EMENI	0.0	1	611	1	611	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|A0A075TRK9|PATE_PENEN	3.55e-164	38	604	49	621	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|A1CFL2|PATE_ASPCL	7.11e-164	37	604	47	621	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|Q0CJ60|ATC_ASPTN	3.79e-158	12	609	17	596	Cyclase atC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=atC PE=1 SV=1
sp|A0A1U8QYA8|CICC_EMENI	2.03e-144	38	607	33	607	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000818	0.999154	CS pos: 19-20. Pr: 0.9670

TMHMM  Annotations     

There is no transmembrane helices in AN3229-T-p1.