CAZyme Information: AN3049-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN3049-T-p1
• CAZy Family: GH16
• CAZyme Description: Putative endo-mannanase GH76 family protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
462	ChrVI_A_nidulans_FGSC_A4|CGC1	51547.03	4.5885

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrVI_A_nidulans_FGSC_A4:2007295-2009051(-)

Full Sequence      

MRWGTLRSLAGSALAVLLLGQLVVADIPIEVSSTESLKQAGKEIAAPMMTFYAQNQTEGI
PGKLTDTWYVAGAMFMTLIQYWQASGDDQYNSIVSHDLMFQAGRNYDFFDSNYSRWLGND
DQMFWGLAAITASETGFPEIENKPTWTTLARAVFNMQANRWDMSACNGGINWQIHAWQKG
NKLRNSISNGGLFQLAARLGRFTENSTYFEFAEKIWDWSVDSPLITPDQDWFVADSTTGQ
SNCTESGNMQWSYNYGSYLAGCAFMYNALTRLGQTGDEKWLRATTGLLARLETTFFPAEY
DHSVMSEVSCEKLHTCDRNMLCFKGWTAMWMALTANLVPQTRATIVPKLQGSAAAIGRQC
DGESENLCGSRWYQDTWDGIKGLEVQMAALGGITSNLMLMTEATAKTINTNPDAKEQHLE
THDDDPAILRTITTGDRVGSWILTAAWSIGILSAAWWLVRQD

Enzyme Prediction     

No EC number prediction in AN3049-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	32	406	1.4e-92	0.9581005586592178

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	3.87e-167	36	390	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	0.002	176	259	137	215	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA63620.1|GH76	0.0	1	462	1	499
EAA66492.1|GH76	2.44e-235	1	462	1	464
BCS18858.1|GH76	2.80e-231	1	462	1	461
QMW48345.1|GH76	1.63e-215	11	462	10	458
QRD92720.1|GH76	1.63e-215	11	462	10	458

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	9.86e-70	30	405	29	411	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36091|DCW1_YEAST	7.33e-86	27	459	22	448	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q6FLP9|DCW1_CANGA	1.15e-83	27	459	19	445	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|Q75DG6|DCW1_ASHGO	3.72e-83	29	459	24	450	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|O74556|YCZ2_SCHPO	2.33e-78	27	409	20	396	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q5AD78|DCW1_CANAL	3.06e-78	29	459	21	451	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000646	0.999315	CS pos: 25-26. Pr: 0.9752

TMHMM  Annotations     

Start	End
438	460