CAZyme Information: AN2923-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN2923-T-p1
• CAZy Family: GT71
• CAZyme Description: Ortholog of A. nidulans FGSC A4 : AN10601, A. fumigatus Af293 : Afu2g17770, Afu8g00650, A. niger CBS 513.88 : An11g02090, An01g01000 and A. oryzae RIB40 : AO090020000174, AO090103000301

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375	ChrVI_A_nidulans_FGSC_A4|CGC8	40638.94	4.5845

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrVI_A_nidulans_FGSC_A4:2385418-2386739(-)

Full Sequence      

MASPTYRKLFSRLTLYAVIVAGVLAFSLWPPISSRSEVAAGSGTLSHLEAIRNETLGTHA
IFAISLPSRVDKRDNIILGSSVRGFHIEIIDATTPEEIDAKTYPYNWNYDHRPVDILKER
LASAIIMEDDADWDVSIKSQLQSFAIAVRALQGAADETTGSSSSPYGDDWDILWLGHCGI
ECSTDRPYYLTPADPTVPPPGHFLPYWRDPPPLARPDDARMTCPITDGVCSIVYAVSFRG
AQRILAALSVNPSGLAEQIDIGAQFDVSLGRMCGSGYLRCFAPYPSLTGGYKSAGPAAKG
SDINGPDDAMESSNEELRQGPFSHGVMYSTMLNVNQLLAGKQMVLATWDDVPIKEIDPAE
VGVLEGSVQMPKNSP

Enzyme Prediction     

No EC number prediction in AN2923-T-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133474	Glyco_transf_25	5.98e-13	61	134	2	96	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA63494.1|GT25	7.15e-219	57	375	10	339
BCS25421.1|GT25	1.26e-171	1	370	1	382
BCS04381.1|GT25	1.22e-153	5	368	5	370
BCS15969.1|GT25	1.22e-153	5	368	5	370
CAK40570.1|GT25	9.48e-146	5	370	5	372

PDB Hits     

AN2923-T-p1 has no PDB hit.

Swiss-Prot Hits     

AN2923-T-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999499	0.000544

TMHMM  Annotations     

Start	End
13	32