CAZyme Information: AN2804-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN2804-T-p1
• CAZy Family: GH142
• CAZyme Description: Putative beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
566		63647.15	5.5202

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrVI_A_nidulans_FGSC_A4:2763465-2765165(-)

Full Sequence      

MSLPHLAQTPNGFQLVVKDKPVLLLPGELHNSSLSSARYMSTVWNYMKEQCINTLLGAVT
WEMVEPVEGQFDFTELDSVITDARKHGLYLVLLWFGSYKNGVSTYVPPWVKRDIVRFPRV
QVWDADKGRKRTIEMISPFTEEGWKADARAFGKLMEHLKEFDSQHSTVVMVQVENETGLL
GDSRDRSTVAERVFAKGFPPELLRHLSTSKSLHPRFIERFGNRLPPSGEINDGQTYAWES
IFGPGTAADEAFMAHYISEYVGHVADAGKKAYPIPLYTNTWLNFDDPSVLDLHGYPNVVG
GGARPGIYPSGGPCPHVSDIWRFNAPALDFLAPDLYFHDYERVCQDYTVPTTNPLFIPEQ
RRDDHGARRVWLAYASYGALGTSPFGVDTEATKIGKEYRLLSQTAGYLLNSPPRQRMGFF
FDELPETGSPKGKQKWTKVFGNIEVIIERAFVFGKPGPGGGMIIQLYDETSYRFLVVGRG
FQVRFRGLDDTVTFTGILEAQEKEVDSETGELRTLRVLNGDETRSGEFLIMPNEDPDYGG
FPIAVTIPAKTYIAEVEAYTICEKKI

Enzyme Prediction     

No EC number prediction in AN2804-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	15	194	3.1e-31	0.5342019543973942

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407954	DUF5597	7.68e-30	394	530	1	130	Domain of unknown function (DUF5597). This is the C-terminal domain of xyloglucan utilization locus (XyGUL) present in Cellvibrio japonicas. XyGUL is required for xyloglucan utilization. It is also the C-terminal domain of PF02449 and PF01301.
396048	Glyco_hydro_35	7.63e-10	14	185	1	158	Glycosyl hydrolases family 35.
396834	Glyco_hydro_42	2.36e-08	47	281	19	238	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
224786	GanA	5.02e-05	12	336	5	366	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
214750	Glyco_10	8.81e-04	61	113	3	50	Glycosyl hydrolase family 10.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA63238.1|GH35	0.0	1	566	1	466
UPL04311.1|GH35	2.85e-269	2	563	14	559
UQC79476.1|GH35	8.38e-260	1	565	9	564
CEI70370.1|GH35	2.78e-256	2	565	8	556
CZS85660.1|GH35	9.46e-250	4	565	10	556

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4D1I_A	3.15e-62	3	526	4	520	The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],4D1I_B The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],4D1I_C The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],4D1I_D The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],4D1I_E The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],4D1I_F The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],4D1I_G The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],4D1I_H The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],4D1J_A The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicas in complex with 1-Deoxygalactonojirimycin [Cellvibrio japonicus Ueda107],4D1J_B The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicas in complex with 1-Deoxygalactonojirimycin [Cellvibrio japonicus Ueda107],4D1J_C The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicas in complex with 1-Deoxygalactonojirimycin [Cellvibrio japonicus Ueda107],4D1J_D The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicas in complex with 1-Deoxygalactonojirimycin [Cellvibrio japonicus Ueda107],4D1J_E The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicas in complex with 1-Deoxygalactonojirimycin [Cellvibrio japonicus Ueda107],4D1J_F The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicas in complex with 1-Deoxygalactonojirimycin [Cellvibrio japonicus Ueda107],4D1J_G The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicas in complex with 1-Deoxygalactonojirimycin [Cellvibrio japonicus Ueda107],4D1J_H The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicas in complex with 1-Deoxygalactonojirimycin [Cellvibrio japonicus Ueda107]
5JAW_A	3.88e-62	3	526	14	530	Structure of a beta galactosidase with inhibitor [Cellvibrio japonicus Ueda107],5JAW_B Structure of a beta galactosidase with inhibitor [Cellvibrio japonicus Ueda107],5JAW_C Structure of a beta galactosidase with inhibitor [Cellvibrio japonicus Ueda107],5JAW_D Structure of a beta galactosidase with inhibitor [Cellvibrio japonicus Ueda107],5JAW_E Structure of a beta galactosidase with inhibitor [Cellvibrio japonicus Ueda107],5JAW_F Structure of a beta galactosidase with inhibitor [Cellvibrio japonicus Ueda107],5JAW_G Structure of a beta galactosidase with inhibitor [Cellvibrio japonicus Ueda107],5JAW_H Structure of a beta galactosidase with inhibitor [Cellvibrio japonicus Ueda107],6TBF_A Chain A, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBF_B Chain B, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBF_C Chain C, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBF_D Chain D, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBF_E Chain E, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBF_F Chain F, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBF_G Chain G, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBF_H Chain H, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBG_A Chain A, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBG_B Chain B, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBG_C Chain C, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBG_D Chain D, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBG_E Chain E, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBG_F Chain F, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBG_G Chain G, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBG_H Chain H, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBH_A Chain A, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBH_B Chain B, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBH_C Chain C, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBH_D Chain D, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBH_E Chain E, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBH_F Chain F, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBH_G Chain G, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBH_H Chain H, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBI_A Chain A, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus],6TBI_B Chain B, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus],6TBI_C Chain C, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus],6TBI_D Chain D, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus],6TBI_E Chain E, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus],6TBI_F Chain F, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus],6TBI_G Chain G, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus],6TBI_H Chain H, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus],6TBJ_A Chain A, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBJ_B Chain B, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBJ_C Chain C, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBJ_D Chain D, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBJ_E Chain E, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBJ_F Chain F, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBJ_G Chain G, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBJ_H Chain H, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBK_A Chain A, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBK_B Chain B, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBK_C Chain C, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBK_D Chain D, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBK_E Chain E, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBK_F Chain F, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBK_G Chain G, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBK_H Chain H, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107]
3U7V_A	7.83e-62	4	526	40	535	The structure of a putative Beta-galactosidase from Caulobacter crescentus CB15. [Caulobacter vibrioides NA1000]
7KMN_A	1.45e-61	5	388	20	364	Chain A, Beta-galactosidase, GH35 family [Xanthomonas citri pv. citri str. 306],7KMO_A Chain A, Beta-galactosidase, GH35 [Xanthomonas citri pv. citri str. 306]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8GX69|BGA16_ARATH	7.25e-06	9	181	26	186	Beta-galactosidase 16 OS=Arabidopsis thaliana OX=3702 GN=BGAL16 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000065	0.000000

TMHMM  Annotations     

There is no transmembrane helices in AN2804-T-p1.