CAZyme Information: AN2774-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN2774-T-p1
• CAZy Family: GH13|GH13
• CAZyme Description: Has domain(s) with predicted transferase activity, transferring glycosyl groups activity

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
330	ChrVI_A_nidulans_FGSC_A4|CGC14	37310.40	6.3675

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrVI_A_nidulans_FGSC_A4:2840708-2841838(-)

Full Sequence      

MARSSEPKLQPRKVWASLITTLSYLPGLLTLHHSLTLSKTAYPFVALYTPSFPPSGLEAL
RRRGITTLAVPFVKPKSTPKHGYAHDPRFEDAWNKLVVFSLEGVFERVVLLDGDMLVRRN
MDELMEVPLDGDDQIGNERDGEVNGAGERIFAASHACACNPMKKAHYPAHWIPENCAFTT
QHQAPDLAQKAGVPCTSGVGMLNSGLLVVRPSHAHFATIQRFLDDAGKVDSYTFPDQELI
SEAFREKWVPLPYVYNALKTMRPRDVHGAIWRDEEVKNVHYIFAVKPWQEVPPAVDQETG
ESTDVLNSWWWEVNIDRQKYEKERGIEDGY

Enzyme Prediction     

No EC number prediction in AN2774-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	17	290	2.6e-36	0.8638132295719845

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	7.40e-50	14	311	2	235	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
279798	Glyco_transf_8	6.40e-09	95	288	89	248	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
133037	GT8_A4GalT_like	1.74e-08	106	289	97	247	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
215090	PLN00176	1.02e-05	39	313	50	290	galactinol synthase
132996	Glyco_transf_8	2.97e-04	95	288	86	244	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA63208.1|GT8	5.01e-212	1	330	1	292
BCS22968.1|GT8	1.47e-167	1	330	1	330
QRD94212.1|GT8	4.27e-127	10	330	4	312
BAE63310.1|GT8	4.27e-127	10	330	4	312
QMW46104.1|GT8	4.27e-127	10	330	4	312

PDB Hits     

AN2774-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q947G8|GOLS1_SOLLC	1.30e-09	24	325	32	289	Galactinol synthase 1 OS=Solanum lycopersicum OX=4081 GN=GOLS1 PE=2 SV=1
sp|Q8H1S1|GOLS6_ARATH	1.55e-06	24	316	37	296	Galactinol synthase 6 OS=Arabidopsis thaliana OX=3702 GN=GOLS6 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999036	0.000988

TMHMM  Annotations     

There is no transmembrane helices in AN2774-T-p1.