CAZyme Information: AN2631-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN2631-T-p1
• CAZy Family: GH134
• CAZyme Description: Putative alpha-L-rhamnosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
662	ChrVI_A_nidulans_FGSC_A4|CGC25	72830.74	6.8112

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrVI_A_nidulans_FGSC_A4:3321083-3323265(-)

Full Sequence      

MDNYRINRYDLNNNFSVYTNRLIQGGLRYQKLNLFTVGTLTLSKVGFLPAVDDTPISKLP
GVFRCSDPVLTRICEVGARTMQLTEFSAGSLPDFWMITEEGALVESQTPQPFSSDYAPGL
TAFELFFPVKVIRNGFEFTVLSGILGVGIYIFANIANCSISAHTGSTVLDSVYSSVDNGR
IRVSIIDSELLDFEQSTRLMGSFGLGASFDHAAVFPNVSLTTFSSTMYSSQLTNKSALKD
FLLSTNTCSSFASTAGQEYVRGSIILLGPLQMLPGFFSPTAKVRQEQRLTDIPANVTGLI
GYSFNLVSAMSRYYEQTGDRSILVEWAPRDVRVSDWAHSQLLPNRLLSISTAAIGRYWNY
YDPQVGGVVAKFNLAYAYALSESIHLLADVGLNVTKHTQRLCELRASVNKHLWSNNLQAY
YHSDSYPGFISQEANALAILSNTIPTVSGNCSANGLLATISRDLSVPAGILAFSPSAVAS
GESVKNLLKTIWAPMRNPQNVNYTGCFWEDLNEDGTPGLGLGTTLCHAWAAGPTADLSRY
VLGIMPITPGFRDWKAEPQTLDLTWAEGRHPVPQGAIGVRWRFSQDGLLQMTVTSPPRTK
EIVYLPAPLKRDMREYRVTGGRTNEDGSFTVQSRTFISPTNCIRNIAFIDILPHYFTYPA
TL

Enzyme Prediction     

No EC number prediction in AN2631-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	250	605	1.3e-47	0.6825396825396826

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
379972	Bac_rhamnosid_C	6.24e-10	543	623	1	76	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA62978.1|GH78	0.0	1	662	1	568
QMW46762.1|GH78	3.32e-237	1	632	115	807
QMW34696.1|GH78	3.79e-236	1	632	115	807
CAK96693.1|GH78	1.47e-235	1	636	113	811
UDD63660.1|GH78	5.61e-234	1	632	328	1020

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	3.78e-11	302	579	385	674	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2OKX_A	9.73e-11	526	617	861	953	Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]

Swiss-Prot Hits     

AN2631-T-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999887	0.000136

TMHMM  Annotations     

There is no transmembrane helices in AN2631-T-p1.