CAZyme Information: AN2612-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN2612-T-p1
• CAZy Family: GH132
• CAZyme Description: Putative beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
838	ChrVII_A_nidulans_FGSC_A4|CGC37	91125.55	5.3105

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrVII_A_nidulans_FGSC_A4:4529914-4532604(-)

Full Sequence      

MGEISPRGGDFDIDYILENASSLEKISLLAGHDFWHTAPLPRFNVPSVRVSDGPNGVRGT
KFFDGVRAACLPCGTGLAATWDQSLLFDAGVLIGQECLAKGAHCWLGPTVCIQRSPLGGR
GFESFAEDPYATGKLAAAYIRGAQSTGVISTIKHFAANDQEHERISVNAVMSERALREVH
LLPFQIAIADAAPGAVMTCYNKINGQHVSESKEMLDGLLRKEWGWKGLIMSDWFGTYSTA
EALNAGLDLEMPGPTRLRGPLLELAISSRKVSRSTLDERARTVLEFVKRANKAEVSTVES
TRDFPEDRRLNRKLAADSIVLLKNESGLLPLNLKALKSAALIGPNMKTAAFCGGGSASLQ
PYYSISPYQGIMNQLPPGVEIIYETGASSYVFIPELEASEVRTPEGQPGLRMRFYREPPS
VKERRVVEETILQESSWQLMGFSNPQLDRLFYADIEAELIAPATGPFEFGLAVYGSGSLF
IDDQLIIDNTTVQRGGNFFFGKGTREEKATVDLVKGQLYKIRVEFASGPSSKLMKPGVVN
FGGGAGRLGMVQAIDPELAIARAVEAAKRADVTILGVGLTRDHESEGFDRSHMDLPPAVA
SLVTAVLDVAPDAILMTQSGTPFNMLPWADNVKTHLHAWFGGNELGNGIADVLFGVVNPS
GKLPLSFPRRIEDTPTYLNFGSERGQVTYGEGIYVGYRYYEKVLRDVLYPFGHGLSYTSF
AYSDFAVDTASATLNVRNSGDVAGAEVVQLYIAADATTSSIARPVKELKGFAKVTLQPGE
TCSVSIPFDRFTTAFWDQEAHVWTCEKGQYRVMVGSSSQNILLEGVLEIKETTTWSGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	41	252	4.5e-65	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	4.74e-86	72	821	121	757	beta-glucosidase BglX.
224389	BglX	1.94e-65	41	345	56	363	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	6.55e-47	536	697	57	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	1.42e-43	58	285	78	315	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	4.33e-34	24	789	64	743	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABF50857.1|GH3	0.0	1	838	1	838
EAA64717.1|GH3	0.0	1	838	1	838
UPK90003.1|GH3	0.0	5	838	9	841
CCT75247.1|GH3	0.0	11	838	15	840
CEI61991.1|GH3	0.0	10	838	14	840

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.42e-240	11	838	4	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	3.31e-236	11	838	4	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	4.57e-137	12	832	4	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.64e-113	24	829	16	663	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	1.32e-97	40	821	87	820	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0YBJ3|BGLK_ASPFC	0.0	1	702	1	666	Probable beta-glucosidase K OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglK PE=3 SV=1
sp|Q4WA69|BGLK_ASPFU	0.0	1	702	1	690	Probable beta-glucosidase K OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglK PE=3 SV=1
sp|Q5BA18|BGLK_EMENI	0.0	1	838	1	838	Probable beta-glucosidase K OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglK PE=2 SV=1
sp|Q2U9M7|BGLH_ASPOR	4.82e-314	12	838	4	827	Probable beta-glucosidase H OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglH PE=3 SV=2
sp|B8NPL7|BGLH_ASPFN	1.95e-313	12	838	4	827	Probable beta-glucosidase H OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999935	0.000092

TMHMM  Annotations     

There is no transmembrane helices in AN2612-T-p1.