CAZyme Information: AN2331-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN2331-T-p1
• CAZy Family: GH11
• CAZyme Description: Protein with pectin lyase activity, involved in degradation of pectin

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379	ChrVII_A_nidulans_FGSC_A4|CGC24	39896.75	4.0865

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrVII_A_nidulans_FGSC_A4:3582340-3583750(-)

Full Sequence      

MKTTFLVSLATAALSSTAAAVSVSGSAEGFAKGVTGGGSATAVYPDTIDELVSYLGDDEA
RVIVLSKTFDFTDSEGTTTETGCAPWGTDAACQVAINQNDWCTNYQPDAPSVSVTYDNAG
TLGITVNSDKTLIGEGSAGVIKGKGLRLVSGTSNVIIQNIAITDINPKYVWGGDAITLND
VDMVWIDHVTTARIARQHIVLGTEADNRVTISNSFINGESDYSATCDGYHYWGIYLDGSS
DMVTMKGNYIYHTSGRSPKVQGNTLLHAVNNYWHDNSDHAFEIGEGAYVLAEGNVFQNIP
TVAEDPIEGELFASPSESANEVCSTYLGRVCELNGFGSSGTFNQADTDFLSKFEGKNIAS
ADSYSSVASSVASSAGNTL

Enzyme Prediction     

EC	4.2.2.10:25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	114	298	1.2e-90	0.9893048128342246

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	2.61e-54	112	298	2	188	Amb_all domain.
226384	PelB	8.71e-14	25	298	32	275	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	1.90e-13	124	296	30	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABF50854.1|PL1_4|4.2.2.10	7.40e-273	1	379	1	379
EAA64442.1|PL1_4|4.2.2.10	5.50e-269	1	379	1	392
BCS20241.1|PL1_4	7.59e-225	1	376	1	376
BCR88479.1|PL1_4	2.95e-222	1	376	1	376
QKX62332.1|PL1_4	9.55e-214	19	376	18	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IDK_A	1.31e-207	21	376	1	355	Pectin Lyase A [Aspergillus niger]
1IDJ_A	1.38e-202	21	376	1	355	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
1QCX_A	1.43e-176	23	361	3	341	Pectin Lyase B [Aspergillus niger]
3VMV_A	1.62e-07	131	309	82	259	Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 [Bacillus sp. N16-5],3VMW_A Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 in complex with trigalacturonate [Bacillus sp. N16-5]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BAU9|PELA_EMENI	1.32e-273	1	379	1	379	Pectin lyase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelA PE=1 SV=2
sp|A1CYC2|PELA_NEOFI	9.90e-216	9	376	7	374	Probable pectin lyase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pelA PE=3 SV=2
sp|Q4WV10|PELA_ASPFU	1.51e-215	1	377	1	377	Probable pectin lyase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pelA PE=3 SV=1
sp|Q4WIS6|PELB_ASPFU	4.46e-212	9	376	7	374	Probable pectin lyase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pelB PE=3 SV=1
sp|B0XT36|PELA_ASPFC	4.46e-212	9	376	7	374	Probable pectin lyase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pelA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000255	0.999710	CS pos: 20-21. Pr: 0.9591

TMHMM  Annotations     

There is no transmembrane helices in AN2331-T-p1.