CAZyme Information: AN2015-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN2015-T-p1
• CAZy Family: PL4
• CAZyme Description: Has domain(s) with predicted transferase activity, transferring glycosyl groups activity and membrane localization

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
503	ChrVII_A_nidulans_FGSC_A4|CGC35	56917.53	5.7030

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrVII_A_nidulans_FGSC_A4:2570498-2572009(+)

Full Sequence      

MSTKMNLRDRSPMSSSWVWKKKLPRFLAAACLIGTLLFFIGPRINHHKLEEDIVQAASDT
AKTVADITAQPPPAENITVTSKVGCEPDLDVLERLGVKKLSKYVRREVIAVQAPMNPPLT
QVLETPLFDKHSIGWRAPENAEPLQSDCSIATPLTLQVPRPVEHIDASHFDFGVATTLDR
LNESLDAFTHWAGNTGVRIFALIEPDRRVPEVLAKAERLGIQLFVTESGEEYQTRYFSLV
SHLAHNLREETRWSCIIDDDTFFLSISALVEAFEHYDHTQQMYVGGVSESVAQIGLFGLM
GFGGAGVFLSRPLIEQLSKPEVFDACQQMVYTGDRRISLCVYQYSDASLTIDHRLRQLDF
RGDASGFFEAARPLPLSVHHWKSWFHTDMTKLSQVSEVCGDSCLLRKFRFADGWTLTNGF
SIIKYSKELSLDDHSMELTWDGDHGANREAFMHELGPLREKDDGKVSYLMADSVTDGNQV
RQWYIRRDESNGDAVFELTWRRQ

Enzyme Prediction     

No EC number prediction in AN2015-T-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215605	PLN03153	2.88e-09	250	380	210	341	hypothetical protein; Provisional
398362	DUF604	5.89e-06	305	380	14	90	Protein of unknown function, DUF604. This family includes a conserved region found in several uncharacterized plant proteins.
367085	Fringe	1.65e-04	252	318	86	160	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA64847.1|GT31	0.0	1	503	1	503
BCS20602.1|GT31	6.08e-259	1	503	1	486
BAE58287.1|GT31	3.85e-212	13	503	12	485
UDD56605.1|GT31	3.85e-212	13	503	12	485
QMW40633.1|GT31	2.21e-211	13	503	12	485

PDB Hits     

AN2015-T-p1 has no PDB hit.

Swiss-Prot Hits     

AN2015-T-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999982	0.000056

TMHMM  Annotations     

Start	End
23	40