CAZyme Information: AN1429-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN1429-T-p1
• CAZy Family: CE3
• CAZyme Description: Putative choline oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
542	ChrVII_A_nidulans_FGSC_A4|CGC17	60019.18	6.7286

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrVII_A_nidulans_FGSC_A4:755022-756702(-)

Full Sequence      

MATTTEFPASDVNSYDYVIVGGGTAGCVIASRLAQYLPNKRILLIEAGPSDYMDDRVLNL
REWLNLLGGELDYDYPTVEQPMGNSHIRHSRAKVLGGCSSHNTLISFRPFEYDCKRWESQ
GCTGWSFETFTRVLDSLRNTVQPVHDRHRNQLCKDWIQSCSTAMNIPIIHDFNKEIRSNG
ELTQGVGFFSVAYNPDDGRRSSASVAYIHPILRGDEKRPNLTILTNAWVSRVNVDGDTVT
GVDITLQSGAKHTLRPKKETILCAGAVDTPRLLLHSGLGPKQQLASLGIPVVKDIPGVGE
NLLDHPESIIIWELNQPVPPNQTTMDSDAGIFLRREAPNAAGSDGSAADVMMHCYQIPFC
LNTSRLGYDTPVDAFCMTPNIPRPRSRGRLYLTSSDPTVKPALDFRYFTDPEGYDAATIV
HGLKAAREIAKQSPFKDWIKREVAPGPKVQTDEELSEYGRRVAHTVYHPAGTTKMGDVTR
DPMAVVDPKLKIRGLKNVRIADAGVFPEMPTINPMLTVLAIGERAAELIAEEAGWKREQP
RL

Enzyme Prediction     

No EC number prediction in AN1429-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	10	538	3e-93	0.5194174757281553

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	6.90e-121	13	534	6	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	3.94e-113	13	529	4	531	choline dehydrogenase; Validated
398739	GMC_oxred_C	2.08e-45	384	525	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	4.21e-34	13	522	54	569	Protein HOTHEAD
366272	GMC_oxred_N	1.68e-26	15	307	1	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA64559.1|AA3_2	0.0	1	542	1	542
BCS21375.1|AA3_2	0.0	1	542	1	542
BCS03844.1|AA3_2	0.0	1	542	90	631
BCS15458.1|AA3_2	0.0	1	542	1	542
CAK47101.1|AA3_2	0.0	1	542	1	542

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JBV_A	1.02e-126	15	529	14	526	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	1.45e-126	15	529	14	526	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	4.07e-126	15	529	14	526	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
6YS2_AAA	2.09e-59	15	533	8	564	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
7AV4_AAA	4.12e-59	15	533	84	640	Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7X2H8|CHOX_ARTGO	5.26e-126	15	529	14	526	Choline oxidase OS=Arthrobacter globiformis OX=1665 GN=codA PE=1 SV=1
sp|Q988C9|4PADH_RHILO	3.09e-75	14	530	6	534	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q4L9D7|BETA_STAHJ	1.61e-73	10	529	2	534	Oxygen-dependent choline dehydrogenase OS=Staphylococcus haemolyticus (strain JCSC1435) OX=279808 GN=betA PE=3 SV=1
sp|Q8NUM0|BETA_STAAW	4.72e-72	14	529	7	536	Oxygen-dependent choline dehydrogenase OS=Staphylococcus aureus (strain MW2) OX=196620 GN=betA PE=3 SV=1
sp|Q6G664|BETA_STAAS	4.72e-72	14	529	7	536	Oxygen-dependent choline dehydrogenase OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000073	0.000007

TMHMM  Annotations     

There is no transmembrane helices in AN1429-T-p1.