CAZyme Information: AN1416-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN1416-T-p1
• CAZy Family: CE3
• CAZyme Description: Has domain(s) with predicted N-acetyltransferase activity, hydrolase activity, hydrolyzing O-glycosyl compounds activity and role in carbohydrate metabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
831	ChrVII_A_nidulans_FGSC_A4|CGC27	90701.62	6.8835

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrVII_A_nidulans_FGSC_A4:715907-718402(-)

Full Sequence      

MGIAATGSKDLAHDIAFATAQELKAVGFNWILGPVLDVLTNVRNQLMGVRTCGDDPQEVS
QYGVEFMKGYQQAGLSTCGKHFPSYGNLEFLGSQTDVPIITESLEQLSLTALVPFRNAIM
NGLDAMMVGGVSMSSAGVNVMHACLSEQVVDDLLRKDMKFDGVVVSECLEMEALTHNIGV
GGGTVMAKNAGCDIILLCRSFQVQQEAINGMKLGVENGIINRTRIEESLRRVLAMKGRCT
SWEQALNPGGLPSLTQMQPSHTSLSTRAYSNSISVVRDNRNLLPLTNVLSSNEELLLLTP
LVNPLPASAVSRSVTEHLELSADAVAWDRTASVLSGESVFKELGRSLSRHRNGRVLHTSY
TSNGVRPIHESLIDRASAVIVITADAVRNIYQQGFTKHVSMICKSQLTPSGEPLDKPLVV
VAVSSPYDFAMDASIGTYLCTYDFTDTALETLVKVLYGELTPTGSLPGSFNRSQKLHQAR
QHWLVENWNEERDSDALDALLKTMGPELSGVTPSSFLLRRDDIDEAHFVVRNSTTRALYG
FCSTYYFRATGTGVIGSLIVDPSRRRLSIGNSLHNRAIRTLMQRKGMKRFQLGSRLPGIY
LGIPAANPVERKKRRQWFANLGWNTALSRPVCNVALRNLQTWSPPEGLVNSLQSADAVYD
LVHGWDYADSIIDHVKTNSRQGVIDIYKIALGGAPHCGIIRARRPHDGAILGSVVIYNMQ
ATLAEHMPATKAMHVPTGGISSPVIWPSVGEYATLLQGLILLGIKQIRRQGADAVVIDCV
SSIFNLSVHANLPQVDVDSNFDWLTEIGFTTLHSYEEVNCDAATWTMVPGP

Enzyme Prediction     

No EC number prediction in AN1416-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	1	196	1.3e-46	0.8379629629629629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	1.11e-53	1	286	87	351	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	1.88e-45	1	233	92	314	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	4.77e-27	9	246	96	316	beta-hexosaminidase; Provisional
178629	PLN03080	5.22e-08	48	285	169	415	Probable beta-xylosidase; Provisional
185053	PRK15098	4.64e-06	1	236	124	353	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA64546.1|GH3	0.0	1	831	108	923
BCS21378.1|GH3	0.0	1	831	108	967
CAK47105.1|GH3	0.0	1	831	284	1107
BCS15461.1|GH3	0.0	1	830	108	930
BCS03847.1|GH3	0.0	1	830	90	912

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	1.81e-64	1	646	100	700	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	3.14e-48	1	467	103	528	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	4.18e-28	1	467	142	614	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	6.42e-28	1	467	116	588	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	7.59e-28	1	467	146	618	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7WUL3|NAG3_CELFI	1.28e-30	1	467	109	552	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
sp|P40406|NAGZ_BACSU	2.15e-27	1	467	142	614	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|Q3SKU2|NAGZ_THIDA	1.24e-22	8	208	97	293	Beta-hexosaminidase OS=Thiobacillus denitrificans (strain ATCC 25259) OX=292415 GN=nagZ PE=3 SV=1
sp|Q1H075|NAGZ_METFK	3.05e-20	8	237	97	313	Beta-hexosaminidase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) OX=265072 GN=nagZ PE=3 SV=1
sp|Q2Y863|NAGZ_NITMU	5.51e-20	8	200	97	285	Beta-hexosaminidase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71) OX=323848 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000036	0.000005

TMHMM  Annotations     

There is no transmembrane helices in AN1416-T-p1.