CAZyme Information: AN1332-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN1332-T-p1
• CAZy Family: CE3
• CAZyme Description: Putative exo-1,3-beta-glucanase family protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
394	ChrVIII_A_nidulans_FGSC_A4|CGC32	43666.75	4.7878

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrVIII_A_nidulans_FGSC_A4:803595-804821(-)

Full Sequence      

MHPLHLLTTALLTTCTSSLPSSLSHQRPKFDDSYTKAFQPFSWSSAKVRGANLGGWLVQE
ASIDTAFWNTYAPDAPDEWTLCTTLGLKCASVLEHRYATFITTSTIDTLASVGVNLLRIP
TTGNQKAYLRKITEYAITNYNMHIVIDVHSLPGGLNGLDIGEKKGNWGWFYNATAWNHSL
EVVDAVVEFIFTSSSPRSFTLEPMNEPTDRNRDDDLTMAVFGTPAALSDRAAAYVMSFWK
AVLERVRTLESGIGSGISGTIPVAFQSFKLPSYWGGNFTADSNVVFDVHNYYFEGRNTTS
ENLPTYMRSDAEEKSITGNGVPVYVGEWAIQAAYNNSFALREKNLNAGLSIWEEYMQGSA
YWTAKFEGTDEVNGEGNKSDYWSFGGFIELGYLG

Enzyme Prediction     

EC	3.2.1.149:1	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	97	375	2e-129	0.9964285714285714

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.28e-07	77	362	49	357	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	7.60e-06	100	368	24	272	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA65515.1|GH5_23	2.75e-295	1	394	1	408
BCS25668.1|GH5_23	1.28e-188	9	393	8	402
QMW31304.1|GH5_23	5.87e-141	14	393	9	383
QMW43350.1|GH5_23	5.87e-141	14	393	9	383
BAE61018.1|GH5_23	5.87e-141	14	393	9	383

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6LA0_A	4.27e-142	42	393	13	364	Chain A, Glycoside hydrolase family 5 [Aspergillus oryzae],6LA0_B Chain B, Glycoside hydrolase family 5 [Aspergillus oryzae]
6I1A_A	3.37e-138	43	393	17	369	Crystal structure of rutinosidase from Aspergillus niger [Aspergillus niger],6I1A_B Crystal structure of rutinosidase from Aspergillus niger [Aspergillus niger]
6ZB9_A	8.97e-14	47	334	2	302	Chain A, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	5.16e-13	47	334	2	302	Chain A, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]
1H4P_A	1.29e-08	48	225	13	211	Crystal structure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae],1H4P_B Crystal structure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WK60|EXGA_ASPFU	5.02e-23	48	329	42	310	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1
sp|A1CRV0|EXGA_ASPCL	2.32e-22	10	328	14	308	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgA PE=3 SV=2
sp|B0XN12|EXGA_ASPFC	4.33e-22	48	329	42	310	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
sp|A1D4Q5|EXGA_NEOFI	1.09e-21	48	329	42	310	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgA PE=3 SV=1
sp|Q9URU6|EXG1_SCHPO	1.16e-20	41	391	32	391	Glucan 1,3-beta-glucosidase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=exg1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.406156	0.593835	CS pos: 23-24. Pr: 0.2680

TMHMM  Annotations     

There is no transmembrane helices in AN1332-T-p1.