CAZyme Information: AN12398-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN12398-T-p1
• CAZy Family: CE12
• CAZyme Description: Ortholog of A. nidulans FGSC A4 : AN6460, A. oryzae RIB40 : AO090023000067, AO090010000683, Aspergillus wentii : Aspwe1_0075588 and Aspergillus versicolor : Aspve1_0086685

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
337		37762.55	4.8612

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrIII_A_nidulans_FGSC_A4:128677-129743(+)

Full Sequence      

MPTRLRLIYLIAGALVLFAFLHLFQGPELSPTSAFLPRDTAGNNTLGFQQIFALSQHPSW
RTRGLDAAANLTGLQITIPPQPPVDDRLVEAFANIQGDPWDTQHPSPGASKAWLAHLDLL
KHVYQSEIETALILEDDVDWDIALRNQMMNISTAVRNLTRAPETDRSPYSLEWDVLWLGH
CGERWDESIETIVFNDTHVCPHEDYRGFWPDEIALLPDLKRTVYRSNSPVCTFAYAVTHK
GARRILESLGAGQGEAFDVQLQIECHSQRLTCVSVVPEVFHQYFPPAQFGVKSDVDIGNN
KGDGPVEETFESVMGSTENILHSARCRALWGSDCQNK

Enzyme Prediction     

No EC number prediction in AN12398-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	98	249	1.2e-18	0.6408839779005525

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133474	Glyco_transf_25	9.33e-06	84	141	39	96	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA60052.1|GT25	1.21e-252	1	333	1	333
BCS17203.1|GT25	7.60e-167	1	334	1	334
UDD59205.1|GT25	5.68e-129	37	337	61	361
BAE58653.1|GT25	5.70e-128	37	337	141	441
QMW28939.1|GT25	1.23e-125	37	334	61	358

PDB Hits     

AN12398-T-p1 has no PDB hit.

Swiss-Prot Hits     

AN12398-T-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999673	0.000351

TMHMM  Annotations     

Start	End
7	26