CAZyme Information: AN11697-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN11697-T-p1
• CAZy Family: PL3
• CAZyme Description: Has domain(s) with predicted transferase activity, transferring glycosyl groups activity and membrane localization

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
489		55732.48	7.2195

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrVI_A_nidulans_FGSC_A4:2087834-2089303(+)

Full Sequence      

MASGRAAFPRPLRLICQALIAGVLIIILGHTAYILHTRVPQFGWEKTIQSSLNGRPPKVP
RPGPTSKWATAESPPECQKFPAAEFAEDGIQVTLKTGGAESRDLLHSHVEGVTSCIPNLL
VVSDMGQQLGPFYTHDVLADVIHVLSEEDRLVYQRQREDHFYWNKKLQPTKAGWRLDRYK
FLAMIEYAYARNPSAKWYVFMEADTTVIWQNLVQLLSRYKWIDPIYIGSPTPGRPIGTWW
DPEPTFFVYGGSGIVLSVTAIEHLLREDLEGSAKAESGQTSQLLITKYQDMVREDCCGDS
VLGWVAAQRDVKIKGLWPMFNPHPLHGTPLGKSYWCQPVITFHKSDPVQVVELWKWQTER
QKKGNDPRPILYSDIVDFFDFEATPVRENWNNADMDSFDASTHEAHDSFDSCKEACHKHD
HCFQFTYHRKKCRMARVIRLGNSVSMDGDGDAKAGRSLAGWDVKKIKEFKKAHNCEKVDW
PEPSTERIF

Enzyme Prediction     

No EC number prediction in AN11697-T-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367085	Fringe	4.48e-07	185	258	75	153	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
215605	PLN03153	0.001	193	266	209	279	hypothetical protein; Provisional
394981	PAN_1	0.005	379	445	2	71	PAN domain. The PAN domain contains a conserved core of three disulphide bridges. In some members of the family there is an additional fourth disulphide bridge the links the N and C termini of the domain. The domain is found in diverse proteins, in some they mediate protein-protein interactions, in others they mediate protein-carbohydrate interactions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS22284.1|GT31	9.67e-210	1	489	1	488
BCS10791.1|GT31	1.46e-105	19	489	23	481
BCR98451.1|GT31	1.46e-105	19	489	23	481
QGA13073.1|GT31	3.20e-103	75	489	62	500
BAE62206.1|GT31	2.85e-101	77	489	83	477

PDB Hits     

AN11697-T-p1 has no PDB hit.

Swiss-Prot Hits     

AN11697-T-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000011	0.000001

TMHMM  Annotations     

Start	End
12	34