CAZyme Information: AN11051-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN11051-T-p1
• CAZy Family: AA9
• CAZyme Description: Putative GH 75 family chitosanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
503		52472.15	4.3927

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrII_A_nidulans_FGSC_A4:742802-744573(+)

Full Sequence      

MRISMSGDSVNFNCRPESPSLFTTSQFEEIIYYMSSNRYLHLITVLFLFASVLCQDIDGS
DDDFPNGGPPASYFRAAPTMPVAALQSAASRLGRTSHGGSFRVSSDSGERSSIYSDWALF
NEGAAVVWTADMDVDCDGIDYGCKGNADGRPETSWGALSAYEVPFIVIPEEYLDKHEAGL
PGNNIAAVICNGNMFYGILGDTNGDSPEVTGEASWLMARTCFPTEGLNGARGHNDPDVTC
IFLLQSPEALALTAKLDIVFLGEDAVLPASAMNDKYITDFDTLRAMGDELVNALVSNIGL
GSGDRARTRTRFRHPLFKAVDAATGTRGTASILNARSWNTTSGLSQSSNSSCTPASGNST
TPCKANASTPATSFPNVSPPSTAKPPTQAASNTATPAVGSTPSASLHAGAASPSVASPSS
AATSAAATSNAPSPPTPTPSCSWPDHCLGAPCFTLDDCSNDLVCVNGLCAVDRDVASLST
SSPTGTPAVRRWITAVRGLGFDD

Enzyme Prediction     

EC	3.2.1.132:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH75	119	293	4.2e-71	0.740909090909091

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399960	Glyco_hydro_75	2.15e-53	132	293	1	165	Fungal chitosanase of glycosyl hydrolase group 75. This family consists of several fungal chitosanase proteins. Chitin, xylan, 6-O-sulphated chitosan and O-carboxymethyl chitin are indigestible by chitosanase. EC:3.2.1.132. The mechanism is likely to be inverting, and the probable catalytic neutrophile base is Asp, with the probable catalytic proton donor being Glu. (see the Chitosanase web-page from CAZY).
236776	PRK10856	0.004	321	400	170	252	cytoskeleton protein RodZ.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA59719.1|GH75	1.09e-238	34	450	565	997
BCS12327.1|GH75	6.92e-101	43	300	9	250
BCS00558.1|GH75	6.92e-101	43	300	9	250
BCS30771.1|GH75	1.65e-95	34	308	1	256
CAK49178.1|GH75	2.61e-95	43	310	9	253

PDB Hits     

AN11051-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q75R32|CSNC_ASPOZ	1.22e-92	46	301	14	251	Endo-chitosanase C OS=Aspergillus oryzae OX=5062 GN=csnC PE=1 SV=2
sp|Q2U5P1|CSNC_ASPOR	2.81e-90	46	301	14	255	Endo-chitosanase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csnC PE=3 SV=1
sp|Q8NK76|CSNB_ASPOZ	5.65e-18	132	294	78	238	Endo-chitosanase B OS=Aspergillus oryzae OX=5062 GN=csnB PE=3 SV=1
sp|Q4WB37|CSN_ASPFU	4.99e-17	107	294	50	240	Endo-chitosanase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=csn PE=3 SV=1
sp|Q2U1H5|CSNB_ASPOR	3.05e-16	132	294	78	239	Endo-chitosanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csnB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.944899	0.055099

TMHMM  Annotations     

There is no transmembrane helices in AN11051-T-p1.