CAZyme Information: AN11000-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN11000-T-p1
• CAZy Family: AA9
• CAZyme Description: Ortholog of Aspergillus flavus NRRL 3357 : AFL2T_11759, Neosartorya fischeri NRRL 181 : NFIA_094100, Aspergillus versicolor : Aspve1_0085617 and Aspergillus clavatus NRRL 1 : ACLA_044880

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
383	ChrIV_A_nidulans_FGSC_A4|CGC9	42662.85	6.2291

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrIV_A_nidulans_FGSC_A4:2395776-2397013(+)

Full Sequence      

MISEATSRTTKAGHLLAHVLRRKPVVFVLLAITLIALYPAGSPFLLPASTPLSPSTSELL
PRPTLAASLSASDLLSRRVSSDRTSIPKLIHQTWFPAGSNMSASAQAWVQTMREQNSDWE
YVLWDDVTNELLVEQYFPWFLETYRSLPKEINRADMARNFYMYLFGGMYADVDTEALRPV
NALFAAHEVPLRRHLDMLSAPDAVSDVQRAFMGRMAHTFDPDGLGAVPNGWMASPPGHPF
WLLPVLYVLENPKGDGSVEGMTGPGILGPLIKQYYSSLTSSDGGISLRRQLCARVQSIQP
GWDLFCPSGYSLDETPESMQSLSHALILLPREQVYPFSWVDDGDVKVCLGAKGNPQFDAD
KCKKRMGVDLWPSYFITYCTHTW

Enzyme Prediction     

No EC number prediction in AN11000-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	106	183	7.2e-17	0.9111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	6.78e-25	16	274	1	243	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.32e-13	109	183	8	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA61879.1|GT32	5.12e-263	1	380	62	440
BCS29894.1|GT32	1.73e-187	9	383	7	380
QRD92713.1|GT32	5.72e-136	21	383	12	362
QMW36295.1|GT32	5.72e-136	21	383	12	362
QMW48351.1|GT32	5.72e-136	21	383	12	362

PDB Hits     

AN11000-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38287|CSH1_YEAST	7.81e-16	86	287	62	237	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	1.34e-14	69	183	39	152	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	4.63e-12	86	253	82	218	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|O14084|IMT1_SCHPO	4.09e-11	86	185	64	164	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|P33300|SUR1_YEAST	5.79e-11	86	274	55	216	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000015	0.000011

TMHMM  Annotations     

Start	End
25	47