CAZyme Information: AN10346-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN10346-T-p1
• CAZy Family: AA7
• CAZyme Description: Putative cutinase with a predicted role in the hydrolysis of cutin

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
223		22698.91	6.2164

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrVI_A_nidulans_FGSC_A4:2649845-2650680(-)

Full Sequence      

MPLPLLPPLLLPLEALLDLALHLVDSTGVAYSARQVTPTAPLPRLRGSSTSNDVTDNSGC
KELTFIFARGTTEIGNMGTVVGPKVGEALKSLTGNKAAIQGVDYPADAAGNAALGGSGGP
KMASLVETALKQCPDTKIVLGGYSQGAMVVHNAASKLSSGQVVGAVTFGDPFKSQKPDNI
DQFKTFCASGDPVCLNGANVMAHLSYGNDAQTAAQFLVSAAGL

Enzyme Prediction     

No EC number prediction in AN10346-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	60	219	7.9e-42	0.9788359788359788

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	1.08e-43	60	220	2	172	Cutinase.
223477	YpfH	5.06e-04	111	194	72	160	Predicted esterase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA63404.1|CE5	2.09e-114	47	223	510	686
BCS30653.1|CE5	2.14e-91	45	223	222	400
BAE58644.1|CE5	7.80e-81	33	223	23	210
QRD85183.1|CE5	1.44e-80	42	223	142	327
QQK39777.1|CE5	1.89e-80	42	222	94	275

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PSC_A	5.42e-35	55	218	74	244	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]
3GBS_A	2.91e-26	50	222	11	197	Crystal structure of Aspergillus oryzae cutinase [Aspergillus oryzae]
3QPD_A	2.47e-25	50	219	2	185	Structure of Aspergillus oryzae cutinase expressed in Pichia pastoris, crystallized in the presence of Paraoxon [Aspergillus oryzae]
7CY3_A	6.35e-24	58	222	15	194	Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9. [Paraphoma sp. B47-9],7CY3_B Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9. [Paraphoma sp. B47-9],7CY9_A Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9 solved by getting the phase from anomalous scattering of uncovalently coordinated arsenic (cacodylate). [Paraphoma sp. B47-9],7CY9_B Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9 solved by getting the phase from anomalous scattering of uncovalently coordinated arsenic (cacodylate). [Paraphoma sp. B47-9]
5X88_A	5.30e-23	37	217	1	194	Chain A, cutinase [Malbranchea cinnamomea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|C8VJF5|CUTI4_EMENI	2.57e-154	1	223	1	223	Cutinase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cut4 PE=2 SV=1
sp|Q00298|CUTI_BOTFU	2.96e-37	32	223	4	202	Cutinase OS=Botryotinia fuckeliana OX=40559 GN=cutA PE=1 SV=1
sp|Q8TGB8|CUTI_MONFR	4.53e-36	32	222	4	200	Cutinase OS=Monilinia fructicola OX=38448 GN=CUT1 PE=2 SV=1
sp|A0A024SC78|CUTI1_HYPJR	2.41e-34	55	218	74	244	Cutinase OS=Hypocrea jecorina (strain ATCC 56765 / BCRC 32924 / NRRL 11460 / Rut C-30) OX=1344414 GN=M419DRAFT_76732 PE=1 SV=1
sp|G0RH85|CUTI1_HYPJQ	2.41e-34	55	218	74	244	Cutinase OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=TRIREDRAFT_60489 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.994923	0.005079

TMHMM  Annotations     

There is no transmembrane helices in AN10346-T-p1.