CAZyme Information: AN10274-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN10274-T-p1
• CAZy Family: AA7
• CAZyme Description: Putative rhamnogalacturonan hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
424		46038.13	4.6896

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrVII_A_nidulans_FGSC_A4:3202232-3203793(-)

Full Sequence      

MYLFRILAILTAFTCASAGRLPSRTCVVPASGTNETDDAPAIISAFERCGRGGKVVFKPT
TYYVNSVMNISWLQDVDIDLRGNLLWSTDIQYWLNNSLEVGYQNQSTAWILGGDNVRIDG
HGIGTLDGNGDYWYEWISQQENTSNYPGRPIALTLSELTNSVVKGVNFLRSQMWTLAIIY
SHHVEFDSILVNNTGNRVDSSNTDGADTIRSSHISFNNLTVYNGDDSISFKANSTDITLT
NSHFYNGLGVAIGSIGQLKDQFETVERVKVENIVYENTLHAVYFKTWTDDQNGYPPNGGG
GGLGYASNMLFKDLDTTSLRGSAVAISQCTRFSGAPGEGNCTNSQFQIRDITVANLHGTT
KSERVTSFQCSAVAPCTNIGVFGVDLEFANGTKAEEYLCGNVKNPRGFVCTGAVCEGGSA
TGEC

Enzyme Prediction     

No EC number prediction in AN10274-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	74	404	4e-62	0.8676923076923077

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215120	PLN02188	2.93e-25	30	403	44	391	polygalacturonase/glycoside hydrolase family protein
395231	Glyco_hydro_28	2.96e-24	108	405	46	318	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
177865	PLN02218	4.46e-22	30	379	75	401	polygalacturonase ADPG
215426	PLN02793	1.19e-18	122	397	149	405	Probable polygalacturonase
178580	PLN03003	4.58e-17	30	415	31	388	Probable polygalacturonase At3g15720

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBF86383.1|GH28	0.0	1	424	1	424
EAA63863.1|GH28	4.12e-296	1	408	1	408
BCS20082.1|GH28	1.26e-271	1	424	1	425
QRD90865.1|GH28	1.62e-243	1	424	1	421
UDD60769.1|GH28	1.89e-242	1	424	1	421

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C2L_A	7.63e-36	26	411	19	383	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]
1HG8_A	5.06e-12	104	397	59	342	Endopolygalacturonase from the phytopathogenic fungus Fusarium moniliforme [Fusarium verticillioides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QG68|RGXB_ASPNC	4.99e-164	26	424	34	429	Alpha-L-rhamnosidase rgxB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxB PE=2 SV=2
sp|Q2UP32|RGXA_ASPOR	1.35e-66	24	401	29	427	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rgxA PE=3 SV=1
sp|B8NJB0|RGXA_ASPFN	1.35e-66	24	401	29	427	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rgxA PE=3 SV=2
sp|Q2EQQ2|RGXA_ASPNG	5.40e-66	25	403	31	430	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger OX=5061 GN=rgxA PE=2 SV=1
sp|A2QBB4|RGXA_ASPNC	7.58e-66	25	403	31	430	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxA PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000264	0.999688	CS pos: 18-19. Pr: 0.9751

TMHMM  Annotations     

There is no transmembrane helices in AN10274-T-p1.