CAZyme Information: AN10265-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN10265-T-p1
• CAZy Family: AA7
• CAZyme Description: Ortholog(s) have alpha-1,6-mannosyltransferase activity, role in protein N-linked glycosylation and alpha-1,6-mannosyltransferase complex, endoplasmic reticulum localization

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
499	ChrVII_A_nidulans_FGSC_A4|CGC38	57013.16	5.3045

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrVII_A_nidulans_FGSC_A4:3066600-3068250(+)

Full Sequence      

MNRHAALANGYTAYPRGGQGTFSISPHKFQPRSQPALRRRKQLIQRICLIGGIAFFLLIL
IFPSWRASILPALSLGLLSSPDHLQIQTVRYYDLAQVKGSATGWENGDRVLMCTPLRDAA
SHLPMFFSHLRNLTYPHHLIDLAFLVSDSKDQTNEMLEHMLEELQRDPDRDMPFGEISVI
RKDFGQQVNQDVESRHGFAAQAGRRKLMAQARNWLLSATLRPTHSWVYWRDADVLTAPST
ILEDLMRHDKDVIVPNVWRPLPDWLGGEQPYDLNSWQESETALALAETLDEDAVIVEGYA
EYATWRPHLAYLRDPYGDPDMEMELDGVGGVSILAKAKVFRAGVHFPAFSFERHAETEGF
GKMARRMGFSVVGLPHYTIWHLYEPSVDDLKHMEEMEKERRAREEEEKAQAERAQRTETY
FRDPKVESEIDNAFVRDSVEEEEEKAKDSTLEKDEFKAAEKDSPATGKYMLEKGHDEDKS
AAQKQGAKGNVRIDEETEN

Enzyme Prediction     

No EC number prediction in AN10265-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	87	350	1.3e-125	0.9888059701492538

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	5.00e-162	88	350	1	265	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA64203.1|GT62	0.0	30	499	325	794
BCS20027.1|GT62	4.83e-291	1	441	1	441
QRD89585.1|GT62	1.23e-262	1	440	1	440
UDD59518.1|GT62	1.48e-262	1	440	1	440
QMW42749.1|GT62	7.83e-259	1	440	19	469

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	2.89e-62	89	386	6	304	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32629|ANP1_YEAST	2.57e-158	81	399	54	372	Mannan polymerase II complex ANP1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ANP1 PE=1 SV=3
sp|O74745|ANP1_SCHPO	1.57e-157	20	400	12	390	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|P23642|VAN1_YEAST	7.26e-126	88	400	171	530	Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAN1 PE=1 SV=3
sp|Q00314|VAN1_CANAX	1.44e-121	82	400	69	437	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1
sp|P53697|MNN9_CANAL	3.14e-66	89	384	73	368	Mannan polymerase complex subunit MNN9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN9 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999924	0.000072

TMHMM  Annotations     

Start	End
47	69