CAZyme Information: AN10150-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN10150-T-p1
• CAZy Family: AA7
• CAZyme Description: 1,3-beta-glucanosyltransferase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
304	ChrVIII_A_nidulans_FGSC_A4|CGC27	33277.34	4.9584

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrVIII_A_nidulans_FGSC_A4:1363071-1364156(-)

Full Sequence      

MRVAGIIALLAAAMPAVATRGTFGLALGNQNPDSSCKTADDYKKDFDAIKHLTTLVRTYS
ASDCDTAKNIVPAAKAKGFKVVLGVWPDYDESFNKDFKALKNTVPGNEEVIHAITVGSEC
LYRGDLIDAPKLLKRINQVKQEFDGVEVGTVDSWNKFADGTADPLITGGVTYFMANGFAY
WQGQDIDNATATYFDDMAQAKAHIEKVAGDNAKKIRFGNGESGWPTDGGSDYGAAKASTK
FAEKYYKNAVCAMLTWGIDVFYFEAFDETWKPDTKGDNGELKDEKHWGLFTDDRKAKFDL
SCPN

Enzyme Prediction     

No EC number prediction in AN10150-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	25	302	2.1e-41	0.9903536977491961

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.55e-63	16	294	39	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	4.73e-42	28	302	9	309	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA66273.1|GH17	2.99e-225	1	304	182	485
BCS25884.1|GH17	2.04e-184	1	304	1	303
QMW46467.1|GH17	5.43e-157	1	304	1	304
QMW34414.1|GH17	5.43e-157	1	304	1	304
QRD93805.1|GH17	5.43e-157	1	304	1	304

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	2.73e-39	33	297	46	289	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	2.08e-38	33	297	46	289	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]
6FCG_A	1.29e-07	188	300	275	383	Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_B Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_C Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_D Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_E Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_F Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4B2W4|BGL2_ARTBC	1.73e-116	10	302	11	301	Glucan 1,3-beta-glucosidase ARB_02797 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02797 PE=1 SV=1
sp|P15703|BGL2_YEAST	4.28e-69	17	302	21	310	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1
sp|Q5AMT2|BGL2_CANAL	2.95e-68	10	302	9	305	Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BGL2 PE=1 SV=2
sp|P43070|BGL2_CANAX	3.32e-67	10	302	9	305	Glucan 1,3-beta-glucosidase OS=Candida albicans OX=5476 GN=BGL2 PE=3 SV=1
sp|O13990|BGL2_SCHPO	2.16e-62	19	302	38	318	Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bgl2 PE=2 SV=4

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000209	0.999726	CS pos: 20-21. Pr: 0.9304

TMHMM  Annotations     

There is no transmembrane helices in AN10150-T-p1.