CAZyme Information: AN10041-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN10041-T-p1
• CAZy Family: AA6
• CAZyme Description: Ortholog of A. niger CBS 513.88 : An07g01780, Neosartorya fischeri NRRL 181 : NFIA_113800, Aspergillus wentii : Aspwe1_0281884 and Aspergillus versicolor : Aspve1_0082092

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
320	ChrVIII_A_nidulans_FGSC_A4|CGC33	37233.88	7.6698

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrVIII_A_nidulans_FGSC_A4:4244423-4245590(+)

Full Sequence      

MIAIAHTRRRLILTLALVSLLGIFHLSPSFLALASLPWTASRADLTAPVKARRITKASML
YGPRNVFYERALQTHRRHAQKWGYGMEVLQNEIAKGYWNKPSYLLALLIRELSKPVNERV
EWLMWVDADSIIINSLIPLELFLPPSTLDGIHMVASKDHKGLNTGIFFLRVHEWSVRFLI
ETLAYPIYNPGVDLDLQGQRGNMLVHFPGLGEKRWEHMETWLDLVERGVGGWEVPVQETW
YLEETERFWKRVQEARHIIGEYERMKELREKPGSGQRDRDGESETDRLVGELSRALYEEP
FEGKTLQQRIETLRRFFDSA

Enzyme Prediction     

No EC number prediction in AN10041-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	67	191	7.9e-24	0.6016260162601627

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	8.03e-10	63	188	21	170	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.
215617	PLN03182	1.66e-08	84	179	169	262	xyloglucan 6-xylosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA66095.1|GT34	1.04e-214	1	316	1	353
BCS19089.1|GT34	8.14e-109	5	311	7	351
QQK43791.1|GT34	1.43e-84	42	318	18	330
QLI70457.1|GT34	7.60e-81	51	264	51	308
CAP96111.1|GT34	1.55e-79	41	313	34	341

PDB Hits     

AN10041-T-p1 has no PDB hit.

Swiss-Prot Hits     

AN10041-T-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.441208	0.558780	CS pos: 34-35. Pr: 0.2785

TMHMM  Annotations     

Start	End
12	34