CAZyme Information: AN0980-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN0980-T-p1
• CAZy Family: AA4
• CAZyme Description: beta-galactosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1022	ChrVIII_A_nidulans_FGSC_A4|CGC7	112459.13	4.8782

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrVIII_A_nidulans_FGSC_A4:1893856-1897182(+)

Full Sequence      

MATAFWLLLFLLGSLHVLTAAQNSSQSEWPIHDNGLSKVVQWDHYSFYINGQRIFLFSGE
FHYWRIPVPALWRDILEKIKAIGFTGFAFYSSWAYHAPNNQTVDFSTGARDITPIYDLAK
ELGMYIIVRPGPYVNAEASAGGFPLWLTTGAYGSTRNDDPRYTAAWEPYFAEVSEITSKY
QVTDGHYTLCYQIENEYGQQWIGDPRDRNPNQTAIAYMELLQASARENGITVPLTGNDPN
MNTKSWGSDWSDAGGNLDTVGLDSYPSCWSCDVSVCTGTNGEYVPYKVLDYYDYFQEVQP
TMPFFMPEFQGGSYNPWDGPEGGCTEDTGADFANLFYRWNIGQRVSAMSLYMMFGGTNWG
GIAAPVTASSYDYSAPISEDRSIGSKYYETKLLALFTRCAKDLTMTDRLGNGTQYTDNEA
VIASELRNPDTNAAFYVTTHLDTTVGTDESFKLHVNTSKGALTIPRHGGTIRLNGHHSKI
IVTDFNFGSETLLYSTAEVLTYAVFDRKPTLVLWVPTGESGEFAIKGAKSGSVAKCSGCS
NIKFHRDSGSLTVAFTQGEGISVLQLDNGVRVVLLDRQKAYTFWAPALTDNPLVPEGESV
LVSGPYLVRTARLARSTLTLRGDSKGETLEIFAPRKIKKVTWNGKAVEATRTSYGSLKAI
LAKPPSVELPTLNGWKYSDSLPERFPTYDDSGAAWVDANHMTTPNPNKPATLPVLYADEY
GFHNGVRLWRGYFNSSASGVYLNIQGGAAFGWSAWLNGHFLGSHLGSASIQQANGTLDFP
ANTLNTEGTPNVLLVVHDDTGHDQTTGVLNPRGILEARLLSEASDNNDDDSPGFTHWRVA
GTAGGESDLDPVRGVYNEDGLYAERVGWHLPGFDDSKWATVNGTSLSFTGATVRFFRTVI
PPLSIPENTDVSISFVFSTPNVNNTSAGNTSAFRAQLFVNGYQYGRYNPYVGNQVVYPVP
PGILDYNGENTIGVAVWAQTEAGARLNLDWRVNYVLGSSLDAGRLDVSGLRPGWNEERER
FA

Enzyme Prediction     

EC	3.2.1.-:1	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	47	393	1.2e-83	0.9869706840390879

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402180	BetaGal_dom2	3.96e-84	403	582	1	180	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyzes the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C-terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N-terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, pfam01301, which is N-terminal to it, but itself has no metazoan members.
396048	Glyco_hydro_35	3.91e-82	46	394	1	315	Glycosyl hydrolases family 35.
198097	BetaGal_dom2	6.20e-71	402	583	1	182	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyses the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, which is N-terminal to it, but itself has no metazoan members.
404274	BetaGal_dom4_5	1.34e-36	862	982	1	111	Beta-galactosidase jelly roll domain. This domain is found in beta galactosidase enzymes. It has a jelly roll fold.
404274	BetaGal_dom4_5	4.40e-31	688	803	1	111	Beta-galactosidase jelly roll domain. This domain is found in beta galactosidase enzymes. It has a jelly roll fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGS42423.1|GH35	0.0	22	1022	1	1001
EAA66009.1|GH35	0.0	1	1008	1	981
BCS26099.1|GH35	0.0	1	1022	1	1036
BCR96126.1|CBM67|GH35	0.0	11	1022	11	1015
AOV94179.1|GH35	0.0	7	1022	7	1014

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TG7_A	1.33e-176	36	987	2	939	Native structure of beta-galactosidase from Penicillium sp. [Penicillium sp.],1XC6_A Native Structure Of Beta-Galactosidase from Penicillium sp. in complex with Galactose [Penicillium sp.]
5IFP_A	3.37e-170	36	986	42	974	Structure Of Beta-galactosidase From Aspergillus Niger [Aspergillus niger CBS 513.88]
5IFT_A	9.33e-170	36	986	42	974	STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 3-b-Galactopyranosyl glucose [Aspergillus niger CBS 513.88],5IHR_A Structure Of E298q-beta-galactosidase From Aspergillus Niger In Complex With Allolactose [Aspergillus niger CBS 513.88],5JUV_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-b-Galactopyranosyl galactose [Aspergillus niger CBS 513.88],5MGC_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 4-Galactosyl-lactose [Aspergillus niger CBS 513.88],5MGD_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-Galactosyl-lactose [Aspergillus niger CBS 513.88]
4IUG_A	1.14e-168	30	986	36	972	Crystal structure of beta-galactosidase from Aspergillus oryzae in complex with galactose [Aspergillus oryzae]
3OG2_A	1.53e-163	36	986	22	970	Chain A, Beta-galactosidase [Trichoderma reesei],3OGR_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGS_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGV_A Chain A, Beta-galactosidase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B6GW04|BGALB_PENRW	0.0	8	1022	8	1013	Probable beta-galactosidase B OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=lacB PE=3 SV=2
sp|B8NKI4|BGALB_ASPFN	0.0	12	1022	13	1020	Probable beta-galactosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=lacB PE=3 SV=2
sp|B6QLF0|BGALB_TALMQ	0.0	27	1022	22	1009	Probable beta-galactosidase B OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) OX=441960 GN=lacB PE=3 SV=1
sp|Q0CMF3|BGALB_ASPTN	0.0	7	1022	7	1022	Probable beta-galactosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=lacB PE=3 SV=2
sp|B2W791|BGALB_PYRTR	0.0	20	1022	26	1009	Probable beta-galactosidase B OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) OX=426418 GN=lacB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000197	0.999772	CS pos: 20-21. Pr: 0.9843

TMHMM  Annotations     

There is no transmembrane helices in AN0980-T-p1.