CAZyme Information: AN0787-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN0787-T-p1
• CAZy Family: AA3
• CAZyme Description: Mannosyl-oligosaccharide alpha-1,2-mannosidase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
505	ChrVIII_A_nidulans_FGSC_A4|CGC25	55881.14	4.5526

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrVIII_A_nidulans_FGSC_A4:2473065-2474686(+)

Full Sequence      

MRTLLALAALAGFAAARVPAYAITRPVMRSDSRADAVKEAFSHAWDGYYNYAFPHDELHP
ISNGYGDSRNHWGASAVDALSTAIMMRNATIVNQILDHIAAVDYSKTNAMVSLFETTIRY
LAGMISGYDLLKGPAAGLVDDSRVDVLLEQSQNLAEVLKFAFDTPSGVPYNMINITSGGN
DGATTNGLAVTGTLVLEWTRLSDLTGNDEYARLSQRAEDYLLHPEPAQYEPFPGLIGSAV
NIADGKLANGHISWNGGADSYYEYLIKMYVYDPERFGLYRDRWVAAAESSINHLASHPST
RPDVTFLATYNEEHQLGLTSQHLTCFDGGSFLLGGTLLDRQDFVDFGLDLVAGCHETYNS
TLTGIGPEQFSWDPNGVPDSQKELFERAGFYINSGQYILRPEVIESFYYAWRVTGDGTYR
EWVWNAFTNINKYCRTATGFAGLENVNAANGGGRIDNQESFMFAEVLKYSFLTFAPEDDW
QVQKGSGNTFVYNTEAHPFKVYTPQ

Enzyme Prediction     

EC	3.2.1.113:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	40	501	2.8e-134	0.9977578475336323

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	0.0	40	501	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	3.25e-112	30	505	69	522	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABF50845.1|GH47	0.0	1	505	1	505
AAG48159.1|GH47	0.0	1	505	1	505
EAA65617.1|GH47	0.0	1	505	1	506
BCS18383.1|GH47	5.00e-301	1	505	1	498
BAE57653.1|GH47|3.2.1.113	4.59e-279	30	501	37	508

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1KKT_A	2.79e-253	21	501	23	508	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
2RI8_A	8.67e-253	30	501	2	473	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
1HCU_A	3.69e-161	32	501	14	492	Chain A, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_B Chain B, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_C Chain C, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_D Chain D, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei]
1NXC_A	1.24e-65	37	505	24	469	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]
5KKB_A	1.95e-65	37	501	26	467	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BF93|MNS1B_EMENI	0.0	1	505	1	505	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mns1B PE=2 SV=2
sp|B8N417|MNS1B_ASPFN	8.15e-280	30	501	37	508	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mns1B PE=3 SV=2
sp|Q2ULB2|MNS1B_ASPOR	8.15e-280	30	501	37	508	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mns1B PE=1 SV=1
sp|Q0D076|MNS1B_ASPTN	5.61e-275	19	501	23	507	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mns1B PE=3 SV=1
sp|Q12563|MNS1B_ASPPH	5.52e-274	16	501	20	510	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus phoenicis OX=5063 GN=mns1B PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000278	0.999697	CS pos: 29-30. Pr: 0.5059

TMHMM  Annotations     

There is no transmembrane helices in AN0787-T-p1.