CAZyme Information: AN0479-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN0479-T-p1
• CAZy Family: AA3
• CAZyme Description: Probable beta-glucosidase O

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
517		57626.77	5.9968

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrVIII_A_nidulans_FGSC_A4:3430464-3432883(-)

Full Sequence      

MTVLAPWALWEKTKDVMVLEQQYQSMCTWIAAIPENMKRHRHLCDPVVLQFAVAVRESNP
WAVMTAYHKINGVHCSEDPRLIRDIPRSEWKYDGLVLCDWWGIYSTSELINAGMDLEMPG
PTDWRCKILAWATRSRKVSIETIDSSVRRVLKLVNRVLAAQSEPVKDSDTEKNRALLRET
TAVPVVLLKKNEANVLPLVKDSKTRYALIGDHWKNPAVAGDDSSEVTPYYVSTPYSAFVE
AVGEDSFICAMGCYSHKFAPLLYSTITQPGSDAHGMLLEFFNKDPNGSSDAELLYTTTTE
KTDLKFADSLPPDTVPEYTSSGSAPSRGSRWGCAGWIREAVEIARQVDIPVILTGLSADY
EYEGIDRKSLGLPGRVDELIERVTEANPKTIIITEAGTATTMPWADKTPTVIHSWFGRQE
TGHGIVDILFGDVNPSGRLPLTFPRNLEVPPVYESDPKHIMTISVSLKNTGQCPGAEIVQ
VYVKDVSSSVQRPRKELKSFKKVHLAPGENMKIEVTS

Enzyme Prediction     

No EC number prediction in AN0479-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	48	119	5.2e-17	0.35648148148148145

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396478	Glyco_hydro_3_C	7.37e-47	185	452	1	198	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
185053	PRK15098	1.57e-43	62	516	250	724	beta-glucosidase BglX.
178629	PLN03080	8.72e-15	51	450	250	597	Probable beta-xylosidase; Provisional
405066	Fn3-like	1.73e-13	477	516	1	40	Fibronectin type III-like domain. This domain has a fibronectin type III-like structure. It is often found in association with pfam00933 and pfam01915. Its function is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA66578.1|GH3	0.0	1	517	1	517
QKD62631.1|GH3	3.73e-127	41	516	170	787
CZS81508.1|GH3	1.80e-125	41	516	161	778
SCB65807.1|GH3	2.25e-125	41	516	170	787
UPK95841.1|GH3	3.09e-125	41	516	170	786

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	7.30e-74	51	515	177	792	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	4.98e-71	51	515	177	792	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	4.19e-62	41	516	173	626	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.31e-42	51	513	184	618	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.89e-35	33	513	166	670	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BG51|BGLO_EMENI	0.0	1	517	1	517	Probable beta-glucosidase O OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglO PE=3 SV=1
sp|A1DNN8|BGLJ_NEOFI	3.50e-85	41	515	175	811	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	2.42e-82	20	515	152	787	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|Q4WLY1|BGLJ_ASPFU	3.71e-82	41	516	175	813	Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglJ PE=3 SV=2
sp|B0Y8M8|BGLJ_ASPFC	1.00e-81	41	516	175	813	Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglJ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000000

TMHMM  Annotations     

There is no transmembrane helices in AN0479-T-p1.