CAZyme Information: AN0393-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN0393-T-p1
• CAZy Family: AA2
• CAZyme Description: Putative endo-mannanase GH76 family protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
464		51818.28	4.8064

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrVIII_A_nidulans_FGSC_A4:3694557-3696103(+)

Full Sequence      

MRWGSLLSLGGAALLLQGQLQHVLADIPIEVTSKDSLKEAGKTITGPMWEYYLANQTEGI
PGKLTDTWYVAGAMFMTMIQFWHVSGYNEHNSVVSHDLMFQAGRNYDYFDSNYSQWLGND
DQMFWGLATITASETGFPEVSNKPTWTSLARAVFNMQANRWDERACDGGITWQIHPWQAG
YTLRNSISNGGLFQLAARLGRFTNNQTYFDWAEKIWDWAAASPLIDTNTWFVADSTSGSN
DCVDADRMQWSYNYGTFIAGAAYMYNATKDVKWRNRTEGLVDHVFKHFFPTKYTTAIGPG
TIFSDVACEPLQTCDRNMLNFKGWSSMWLAMAAIMVPELREKITPKLQGSALAIGRSCDG
SSEGKSNLCGSRWYQETWDGIQGLEVQQAALGGITANLMLLTDVVAKTIDTNPGAKEQFL
DTYNDDTPDALPHITTGDRVGSWILTVLWGSGIVAAGWWLVKQQ

Enzyme Prediction     

No EC number prediction in AN0393-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	34	399	7.6e-91	0.9301675977653632

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	8.40e-165	36	391	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	0.005	176	290	137	250	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA66492.1|GH76	0.0	1	464	1	464
BCS18858.1|GH76	4.56e-261	1	464	1	461
EAA63620.1|GH76	2.65e-227	1	464	1	499
QMW48345.1|GH76	8.27e-214	1	464	1	458
QRD92720.1|GH76	8.27e-214	1	464	1	458

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	6.95e-79	30	373	29	373	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6FLP9|DCW1_CANGA	1.33e-89	27	461	19	445	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|P36091|DCW1_YEAST	2.89e-89	27	461	22	448	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q75DG6|DCW1_ASHGO	4.58e-85	29	461	24	450	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|Q5AD78|DCW1_CANAL	1.03e-83	29	461	21	451	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1
sp|O74556|YCZ2_SCHPO	1.92e-77	27	400	20	386	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000274	0.999678	CS pos: 25-26. Pr: 0.9279

TMHMM  Annotations     

Start	End
439	461