CAZyme Information: AN0383-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN0383-T-p1
• CAZy Family: AA2
• CAZyme Description: Putative endo-mannanase GH76 family protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
309	ChrVIII_A_nidulans_FGSC_A4|CGC2	34868.72	4.4547

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrVIII_A_nidulans_FGSC_A4:3722103-3723173(-)

Full Sequence      

MSQYHGNETGQIPGKVPESWWEGAAMFMTLIQYWYWTGDILGPAAMTAAELNFAEKEDQP
LWLSLAQGVFDAQVSRWDETRCGGGMRWQIWPFQGGYITKNAISNGGLFQLAARLGRYTE
NETYIRWAEKIWDWSATTPLLKSDNWTIADTTSMENDCQDHGDQQWTYNYGTYSAGAAYM
YNLVSAFISRNGELQSTAYSQQHATTWRTFIAEDAMSEVWCEQTMSCDRNRDMFKGFLSS
WLTFTATIAPYTASDIIPKIHRSAIGAARQCLGGRSCGRQWNEGDWDGSATMESDTSALS
VYSSSMVAF

Enzyme Prediction     

No EC number prediction in AN0383-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	41	307	2.6e-57	0.664804469273743

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	3.23e-113	1	299	14	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA66482.1|GH76	1.70e-203	1	309	1	286
BCS18882.1|GH76	8.70e-148	1	309	47	387
CAK43770.1|GH76	2.55e-142	1	307	41	384
QMW25974.1|GH76	1.06e-141	1	308	44	389
QRD87981.1|GH76	1.06e-141	1	308	44	389

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	3.28e-52	1	284	48	376	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O74556|YCZ2_SCHPO	5.51e-62	42	299	121	377	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q9P6I3|YHG7_SCHPO	1.53e-61	40	302	112	375	Putative mannan endo-1,6-alpha-mannosidase C1198.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1198.07c PE=3 SV=2
sp|P36091|DCW1_YEAST	1.08e-59	1	301	44	380	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q75DG6|DCW1_ASHGO	8.73e-59	1	301	44	382	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|Q6FLP9|DCW1_CANGA	5.72e-54	1	301	41	377	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000038	0.000003

TMHMM  Annotations     

There is no transmembrane helices in AN0383-T-p1.