CAZyme Information: AN0246-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN0246-T-p1
• CAZy Family: AA11
• CAZyme Description: Ortholog of A. fumigatus Af293 : Afu1g05300, A. niger CBS 513.88 : An01g04570, A. oryzae RIB40 : AO090003000826, Aspergillus wentii : Aspwe1_0049630 and Aspergillus sydowii : Aspsy1_0142918

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
931	ChrVIII_A_nidulans_FGSC_A4|CGC23	105209.18	6.5353

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrVIII_A_nidulans_FGSC_A4:4153346-4156662(+)

Full Sequence      

MIRLSVENGLRALLGFVHRIPTVSPTPVKYSTIPLTELDQSTAEVLSSTGVDDVAKDERT
LKWWLKVGVLSGVSCARIALFRYITDNIECAPTGYSYLIPFLVAIYDLWRNQRATRNWTR
PDDAEDDLLCIPITFASRLRSIILQSRLRCIIPAALLALSGFIITTFQDARHSTYICPIV
SGKHFRLQTLRILAFVLDCLILTGGAELSGEGVRRDGRKLQTLLSWGYSLLGVVLSLAGW
VIYLTATAEAGTFVTSHYLRSAWGQAVLITILTVSASQLLPYYGMAGLCVLAGFIASYFN
LMSTLFEGQEPFPLIPASHAFAALFLLCLGGLLFLLSRTASEEEPQFLHRLNLISRLTIA
VMFGTGLIWVLGQSRLSHTHPIDLLIHEAAKSHDIWLKTAKESSNLAEAVQQYRLRYNQH
PPPSSVTIDEFDGIYANLLPFRALAPHEIRTMTQKLATNPENDIGALSIRNGTVRIQEGI
KPTHAWMVQSAGRMIENFSEHLPDMDLAFNLDDEPRVIAPWEKIAELQNRAKAQQLPADD
DISDEWSPERDATWGPIEPADQTPETMFIDRSFQKIFDPYVAPACPPGSKARTQRVWDKH
DLCIGCIRPHSMGQFPTDWSVTSDICHQPDLAHMHGLFLSPATFRITQELVPVFSQSSTS
VFNDIIFPSPWNYVDKIKYEPSGEHPDSRYTEKENTLFWIGSTTEGVSHEGRWKGMPRQR
LAHLVNNNTYNHVSILLPTDEPKSYSYQIFDGLAPTQVLGLNASVSITDPIVRCRNEDCT
DQKDELGPGGRVDFQDHWRYRYLFDSDGAGFSGRFLPFLQSRSLPFKTGLFRQWFDSRVT
PWLHYAPVDVRLHGLWSTLAYFAGVDANVDGRKIEVKRHDVQGRWIAEEGRKWAETALRK
EDMEIYFFRLLLEWGRLTDDRRDTLGFKFPS

Enzyme Prediction     

No EC number prediction in AN0246-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	629	918	2.6e-76	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	2.95e-13	650	917	30	252	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	2.31e-07	781	917	196	322	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA66119.1|GT90	0.0	1	931	1	874
BCS19053.1|GT90	0.0	1	931	1	964
BCS08186.1|GT90	0.0	10	928	52	994
CAK36993.1|GT90	0.0	10	928	52	994
UDD56219.1|GT90	0.0	16	927	58	991

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	9.98e-09	629	916	95	340	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]
5F84_A	2.45e-06	652	917	154	378	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	8.51e-28	379	924	151	662	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|A0NDG6|RUMI_ANOGA	2.26e-11	647	925	158	396	O-glucosyltransferase rumi homolog OS=Anopheles gambiae OX=7165 GN=AGAP004267 PE=3 SV=1
sp|B0X1Q4|RUMI_CULQU	2.13e-09	775	918	255	389	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q16QY8|RUMI_AEDAE	2.82e-09	775	918	254	388	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|Q8NBL1|PGLT1_HUMAN	5.99e-08	629	916	123	368	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999646	0.000364

TMHMM  Annotations     

Start	End
148	167
187	209
222	244
259	276
283	305
315	337
350	372