CAZyme Information: AN0031-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN0031-T-p1
• CAZy Family: AA1
• CAZyme Description: protein of unknown function

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361		39888.11	5.6615

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrVIII_A_nidulans_FGSC_A4:4812356-4813933(-)

Full Sequence      

MKPPTPISAALFILGLILSPTTTAHGHSHNHNHKPHSHGARAISSRGLDSGPNKPLLAGY
SLTWHEEFNQPSSGAVEQPSAAKWLYATGQSYPASWEDHGLHIESYTADTENIHLTKQGT
LSITPRKKSNRLWTSARIETVRKDFKAERGGKLFIDARIKTGCAAAGVSVSTLEKASPAD
AVTFRFWALGTEIRGNDRDTCLDWPAVSEWDIAEIVQGEEKVHQALHCGTAPGGPCNEFA
GLTSSALWRDCNWHYLGFEVDRTQFSSDGAEMWEDNTLNWYLDGVKTFSLSGRDVGDRDV
WEKIAYQGHFLLLDVAVGRDVTEDQDDTAASSRLEVDYVRVWNSNQTSFFAEFELHDSTG
A

Enzyme Prediction     

No EC number prediction in AN0031-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	64	342	5.8e-40	0.9956521739130435

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185691	GH16_Strep_laminarinase_like	1.43e-81	59	343	1	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
185693	GH16_laminarinase_like	6.25e-29	64	342	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185683	Glyco_hydrolase_16	8.82e-10	66	342	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA65350.1|GH16	7.91e-268	1	361	1	361
EAA58149.1|GH16_3	3.13e-77	55	345	84	383
QKD60230.1|GH16_3	2.70e-74	79	344	46	301
BCS17820.1|GH16_3	5.30e-73	47	344	52	365
CCT75102.1|GH16_3	1.71e-72	79	344	46	301

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7EO3_A	1.56e-48	51	344	1	280	Chain A, 1,3-beta-glucanase [Actinomycetia bacterium]
3DGT_A	1.90e-39	50	318	1	245	The 1.5 A crystal structure of endo-1,3-beta-glucanase from Streptomyces sioyaensis [Streptomyces sioyaensis]

Swiss-Prot Hits     

AN0031-T-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000450	0.999519	CS pos: 26-27. Pr: 0.7610

TMHMM  Annotations     

There is no transmembrane helices in AN0031-T-p1.