CAZyme Information: AMAG_20156-t26_1-p1

Basic Information

• Species: Allomyces macrogynus
• Lineage: Blastocladiomycota; Blastocladiomycetes; ; Blastocladiaceae; Allomyces; Allomyces macrogynus
• CAZyme ID: AMAG_20156-t26_1-p1
• CAZy Family: GT69
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1344		146171.24	7.2537

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AmacrogynusATCC38327	19333	578462	535	18798

Full Sequence      

MASAPSPAGQPPAGPSAAYADDMFDGVGGAGGLLQTNMDATIAAAGTDDVPLSLVVASPP
PPSTADVVPDDVPLAVAAAAANDDVPLALAQQKRRSMYSDHRRSLASLSEANAPASGPTG
SLAPPPPTSSTPGPATGVGAGYAGVTSPARASMIAQQSTQYAQAQYQQQQQQAQAMQQQP
AQQHQDGMLRNLARRISGRRNRPDAVLAAAGTTQPAAAGAVSPHQQPSDLEAVTSGNDAQ
ALALGSNNRPSAPYGNPFANPRNRGYTSNPSGPGNVAGHAPTAPNGAPLPPSISRRPLTL
PRNVDYSRPTTMCRRVWVVFSKVVTFYAIPPVLACFGLKTPEVQLAWREKMALCTIILIM
MTIVGFLTFGFNQVLCQSQDSRMDFVSLGGGYVVINGYGFDVTEYNHNFGTYGQFPFEEI
YAPDRGFAQRDLSFLFQNSYGGLPACQAVFGGEKYTAATNYLFPCTISGLPATAVQDRYG
SYPPEYCHQSTNTLVQDIADFRAKHKRRDIFVKWDALLDEGNPFLAFNGEVVDLSRLDLL
AKKIDYKSLMANTGVDVQKLLARYRNRDASYAFSANATLNNLGTCLTSIARVGSLDSSTV
GCIASDVVLWVSLIVILALVLSRFFMALIFRWVLSPRLGKRLSDDEKRTYLRQRNVRDRD
AQLLRRSTIQQPPFSPFRESMSSPTPPSPSGVSPRPAARFSFYETASQRGSLMFAPDGTL
PPHPASPFMPPEGSPRLIALDGSGTGTPLTRPASVDSASTLSVSRQPLTQGGVISLAAAA
AAAEADKNPDDGIDISVEEVMHCILLVTCYSEGEDGIRATLNSLARTHYLDTHKILFVIA
DGMITGAGEARSTPEIVVSLMEKDPAFPDVPKPYSYVAIADGAKRHNMAQVHAGYYVVDG
HRVPMVCVAKCGTPDEQSAPKPGNRGKRDSQIVLMSFLQKVMFDERMTPLEYDLFQKIHR
IARVTPDAYEMVLMVDADTEVAPDSLERMVASFARDPAVMGLCGETQIANKWGSWVTMIQ
VFEYYISHHLAKAFESVFGGVTCLPGCFCAYRIKTPKGDFGRHWVPILANPDIVEEYSEN
VVDTLHKKNLYLLGEDRYLTTLMLRTFPKRKMIFVPQATCETLVPDQFGVLLSQRRRWIN
STIHNLMELVLVRDLCGTFCISMQFVIFMELVGTVVLPAAISFTIYLVVISFITTPVPII
PLLLLAAVLGLPGVLILLTSRKIQFVFWMIVYIISLPVWNLILPAYAFWHFDDFSWGATR
QVAGMAGKDGHGADDGEFDSTKIIMKRYAEWEMIKRRAIAQALEQQQQLQRRQTAMMNAA
ATGGVYYGVPNQLVHAGSVVEFNG

Enzyme Prediction     

EC	2.4.1.16:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	799	1292	3.2e-258	0.952561669829222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367353	Chitin_synth_2	0.0	802	1292	26	525	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).
133033	Chitin_synth_C	9.53e-93	806	1145	2	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
224136	BcsA	1.07e-20	969	1263	138	412	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	1.94e-20	969	1052	79	162	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
133056	GT2_HAS	3.87e-13	972	1145	81	235	Hyaluronan synthases catalyze polymerization of hyaluronan. Hyaluronan synthases (HASs) are bi-functional glycosyltransferases that catalyze polymerization of hyaluronan. HASs transfer both GlcUA and GlcNAc in beta-(1,3) and beta-(1,4) linkages, respectively to the hyaluronan chain using UDP-GlcNAc and UDP-GlcUA as substrates. HA is made as a free glycan, not attached to a protein or lipid. HASs do not need a primer for HA synthesis; they initiate HA biosynthesis de novo with only UDP-GlcNAc, UDP-GlcUA, and Mg2+. Hyaluronan (HA) is a linear heteropolysaccharide composed of (1-3)-linked beta-D-GlcUA-beta-D-GlcNAc disaccharide repeats. It can be found in vertebrates and a few microbes and is typically on the cell surface or in the extracellular space, but is also found inside mammalian cells. Hyaluronan has several physiochemical and biological functions such as space filling, lubrication, and providing a hydrated matrix through which cells can migrate.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAB41410.1|GT2	CAB41410.1|GT2	4.95e-260	300	1292	183	1180
QGA18874.1|GT2	QGA18874.1|GT2	1.86e-257	317	1296	203	1190
QKX55195.1|GT2	QKX55195.1|GT2	3.06e-256	292	1296	421	1433
UKZ52035.1|GT2	UKZ52035.1|GT2	8.31e-255	307	1296	193	1160
QIW96384.1|GT2	QIW96384.1|GT2	1.14e-253	316	1296	235	1220

PDB Hits     

AMAG_20156-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P78611|CHSD_EMENI	sp|P78611|CHSD_EMENI	2.77e-251	316	1296	186	1169	Chitin synthase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsD PE=1 SV=4
sp|Q01285|CHS4_NEUCR	sp|Q01285|CHS4_NEUCR	1.31e-250	317	1296	211	1191	Chitin synthase 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=chs-4 PE=3 SV=3
sp|O13394|CHS5_USTMA	sp|O13394|CHS5_USTMA	2.77e-244	317	1296	331	1301	Chitin synthase 5 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS5 PE=3 SV=3
sp|P30573|CHS3_CANAX	sp|P30573|CHS3_CANAX	4.64e-244	317	1296	167	1163	Chitin synthase 3 OS=Candida albicans OX=5476 GN=CHS3 PE=3 SV=1
sp|J9VXM5|CHS3_CRYNH	sp|J9VXM5|CHS3_CRYNH	7.96e-242	314	1296	210	1196	Chitin synthase 3 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000011

TMHMM  Annotations     

Start	End
316	338
353	375
571	593
608	630
1171	1193
1197	1219
1226	1248