CAZyme Information: AMAG_19514-t26_1-p1

Basic Information

• Species: Allomyces macrogynus
• Lineage: Blastocladiomycota; Blastocladiomycetes; ; Blastocladiaceae; Allomyces; Allomyces macrogynus
• CAZyme ID: AMAG_19514-t26_1-p1
• CAZy Family: GT62
• CAZyme Description: glycogen/starch/alpha-glucan phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1126		125013.16	7.4602

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AmacrogynusATCC38327	19333	578462	535	18798

• Gene Location: location=GG745351:325520-334729(-)

Full Sequence      

MGVPAAAQSAIGSVIAAAAVAVIVLSAVEPADVEQIQRSIVKHATSTLARTVFNVEKFAA
YQATAHSVRDRLIEEWNVTMQTHTLRDPKRVYYMSLEFLLGRSLDNALLNLQLKNKYGQA
LNSLGFNLEDLIQEEDDAALGNGGLGRLAACYMDSLACLEYPAWGYGLRYTYGIFKQRIV
DGHQTEFPDYWLNFGNPWEVPRLDVVYEVRFYGQCHKYVDADGSVRWKWDGGDKVQAVAY
DVPIPGFNNQTCLNIRLWSSKPKKQFDLGLFNEGNYDKSVEEQQRAENITSVLYPNDNHM
VGKELRLKQQYFFVCATLKDVIRRFKKTNRPWADFPDQVAVQLNDTHPTLGIVELQRRLV
DIEGLEWDEAWKIVTRVFAFTNHTVLPEALETWPVPMMAHLLPRHLAIIYDINLFFLQKV
EAMFPNDRDRLRRMSIIEESSPQRVRMAHLAIVGSHCVNGVAALHSELVKNVIFKDFVDF
YGADKFTNVTNGITPRRWLNQANPQLATLITATIGDGWTKDLTELAKLKAHADKPDFQKK
WMAIKKHNKQRLADLIRKQSGIVVDPESLFDVQVKRIHEYKRQLMNILGVIHRYLALKRM
TPAARANEVKRTRLPPAAPRLLATPPAVPAVPTTTNHNCGNDVNGIDLMLDDDAAPAPTV
RIDAAAAATEQALTTLAEHVRRAHDEARATVAQLAADHAQHVATLSADLAESRDRERMLQ
DEVRRMILETQAMSASLRSVESQTALLDEVESLRRQLAESRQAHDCTTKEREDLRQAHDR
TTRELDKTRRQRDDAAHLAGKTNSDLASATAEVHQLRATLTQYARKRKLVESIGAELAHR
KQKYQVVKHELLTTTEQLRAALAARDRYMHANARLGKAFRVVGDHLGRPAVRALLAGAGL
SINSDAPEAPDRAVVSAEPEPAPPAEDGDVEMREAQTNRRPLLPNATRTRGVAPNAERTC
GVTRLVLSPSPPLAPTAPPSDLDLDAAGIAFDLDSEGPMHPLGQPARRSDPAMSSQTQDT
VGHPPLPKGRPSSPIQIEDKDEDPEVTVVPPDLVRMRSAPAPTPVRPPPGASVLPSPAAP
VAPTAAAVADDDSPRPRKRRAVVDLAAGSVVSSAAADPQQFFVVHL

Enzyme Prediction     

EC	2.4.1.1:158

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT35	120	604	2.5e-191	0.6617210682492581

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340853	GT35_Glycogen_Phosphorylase	0.0	37	612	1	569	glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
395272	Phosphorylase	0.0	121	612	1	436	Carbohydrate phosphorylase. The members of this family catalyze the formation of glucose 1-phosphate from one of the following polyglucoses; glycogen, starch, glucan or maltodextrin.
223136	GlgP	0.0	32	612	5	524	Glucan phosphorylase [Carbohydrate transport and metabolism].
184948	PRK14986	0.0	33	610	14	585	glycogen phosphorylase; Provisional
273967	P_ylase	0.0	40	612	1	568	glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ73690.1|GT35	1.08e-264	32	614	74	657
UKZ47118.1|GT35	1.08e-264	32	614	74	657
QYS93787.1|GT35	1.14e-261	32	614	74	657
UPK96107.1|GT35	6.41e-261	37	614	80	658
QNQ01362.1|GT35	7.08e-261	32	614	79	661

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1YGP_A	1.58e-230	34	611	42	644	Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site. [Saccharomyces cerevisiae],1YGP_B Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site. [Saccharomyces cerevisiae]
3CEH_A	1.85e-182	32	599	1	570	Human liver glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE5688 [Homo sapiens],3CEH_B Human liver glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE5688 [Homo sapiens],3CEJ_A Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE2865 [Homo sapiens],3CEJ_B Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE2865 [Homo sapiens],3CEM_A Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE9423 [Homo sapiens],3CEM_B Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE9423 [Homo sapiens]
1FC0_A	5.68e-182	32	599	23	592	HUMAN LIVER GLYCOGEN PHOSPHORYLASE COMPLEXED WITH N-ACETYL-BETA-D-GLUCOPYRANOSYLAMINE [Homo sapiens],1FC0_B HUMAN LIVER GLYCOGEN PHOSPHORYLASE COMPLEXED WITH N-ACETYL-BETA-D-GLUCOPYRANOSYLAMINE [Homo sapiens],2ATI_A Glycogen Phosphorylase Inhibitors [Homo sapiens],2ATI_B Glycogen Phosphorylase Inhibitors [Homo sapiens]
1FA9_A	5.68e-182	32	599	23	592	HUMAN LIVER GLYCOGEN PHOSPHORYLASE A COMPLEXED WITH AMP [Homo sapiens]
1XOI_A	5.68e-182	32	599	23	592	Human Liver Glycogen Phosphorylase A complexed with Chloroindoloyl glycine amide [Homo sapiens],1XOI_B Human Liver Glycogen Phosphorylase A complexed with Chloroindoloyl glycine amide [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q00766|PHS1_DICDI	1.79e-254	32	611	40	618	Glycogen phosphorylase 1 OS=Dictyostelium discoideum OX=44689 GN=glpV PE=1 SV=3
sp|P06738|PHSG_YEAST	5.41e-231	34	615	65	670	Glycogen phosphorylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPH1 PE=1 SV=4
sp|P34114|PHS2_DICDI	4.43e-210	30	598	108	676	Glycogen phosphorylase 2 OS=Dictyostelium discoideum OX=44689 GN=glpD PE=1 SV=2
sp|Q9XTL9|PYG_DROME	2.52e-182	29	599	21	593	Glycogen phosphorylase OS=Drosophila melanogaster OX=7227 GN=GlyP PE=2 SV=2
sp|Q9Z8N1|PHSG_CHLPN	2.73e-182	32	598	13	578	Glycogen phosphorylase OS=Chlamydia pneumoniae OX=83558 GN=glgP PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.939276	0.060735

TMHMM  Annotations     

There is no transmembrane helices in AMAG_19514-t26_1-p1.