CAZyme Information: AMAG_18874-t26_1-p1

Basic Information

• Species: Allomyces macrogynus
• Lineage: Blastocladiomycota; Blastocladiomycetes; ; Blastocladiaceae; Allomyces; Allomyces macrogynus
• CAZyme ID: AMAG_18874-t26_1-p1
• CAZy Family: GT58
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
393		42363.79	6.7985

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AmacrogynusATCC38327	19333	578462	535	18798

• Gene Location: location=GG745340:613163-615159(-)

Full Sequence      

MSLNLPPVPPRTTPRIASLTTVVLVLALLLATTVPSPALAGKCPKMNKQCPANVPFCNKY
GYCSTTLADGMPQEGCNAGGSYPGVCADRNGCKNFKVDFDSPSQCPPRSSFGGNPDAQPF
YDQFANAEVKDSNVVLHMKYNNQLKSGMISKIASARYFKYGNFSARIRIPNPGKGFAYSF
IWKTSVDRDDVGDEIDFEWIPYKNRHEVQTNWFAGGLIDYTKGISWVFPDNATTTDYHVY
TIVYEPERIVWVVDDIPIRTVKKTGNNGTDFPSSEGMLFASIWDSCLSAPGTQAWAGGPS
EWCGENATSQAKGQDFTMLVDWVQVQCMNGYVDTADTRVVKRPLSSGPSGSSSGGSSIGI
DPSINLNAAARASAHWAWAAGVAGLAAVAGLAL

Enzyme Prediction     

No EC number prediction in AMAG_18874-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	128	298	5.3e-28	0.9425287356321839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185692	GH16_fungal_CRH1_transglycosylase	2.30e-34	150	327	37	201	glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
395585	Glyco_hydro_16	3.78e-32	126	284	5	151	Glycosyl hydrolases family 16.
185685	GH16_XET	1.49e-19	146	284	38	171	Xyloglucan endotransglycosylase, member of glycosyl hydrolase family 16. Xyloglucan endotransglycosylases (XETs) cleave and religate xyloglucan polymers in plant cell walls via a transglycosylation mechanism. Xyloglucan is a soluble hemicellulose with a backbone of beta-1,4-linked glucose units, partially substituted with alpha-1,6-linked xylopyranose branches. It binds noncovalently to cellulose, cross-linking the adjacent cellulose microfibrils, giving it a key structural role as a matrix polymer. Therefore, XET plays an important role in all plant processes that require cell wall remodeling.
185683	Glyco_hydrolase_16	7.26e-19	98	325	2	209	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185684	GH16_lichenase	4.62e-15	152	323	60	208	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS61834.1|CBM18|GH16_19	1.22e-27	43	302	26	275
BCS29145.1|CBM18|GH16_19	1.70e-27	47	334	31	307
ADK37843.1|CBM18|GH16_19	2.19e-27	55	327	33	283
QSS71477.1|CBM18|GH16_19	5.97e-25	47	327	29	297
ADK37842.1|GH16_19	9.52e-25	38	327	14	283

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5SV8_A	5.02e-13	150	297	45	183	Crystal Structure of the catalytic nucleophile and surface cysteine mutant of VvEG16 in complex with a xyloglucan oligosaccharide [Vitis vinifera]
5DZE_A	3.10e-12	150	297	44	182	Crystal Structure of the catalytic nucleophile mutant of VvEG16 in complex with cellotetraose [Vitis vinifera]
5DZF_A	3.15e-12	150	297	45	183	Crystal Structure of the catalytic nucleophile mutant of VvEG16 in complex with a mixed-linkage glucan octasaccharide [Vitis vinifera],5DZF_B Crystal Structure of the catalytic nucleophile mutant of VvEG16 in complex with a mixed-linkage glucan octasaccharide [Vitis vinifera]
5DZG_A	3.21e-12	150	297	46	184	Crystal Structure of the catalytic nucleophile mutant of VvEG16 in complex with a xyloglucan tetradecasaccharide [Vitis vinifera],5DZG_B Crystal Structure of the catalytic nucleophile mutant of VvEG16 in complex with a xyloglucan tetradecasaccharide [Vitis vinifera]
1UMZ_A	6.37e-11	158	285	57	182	Xyloglucan endotransglycosylase in complex with the xyloglucan nonasaccharide XLLG. [Populus tremula],1UMZ_B Xyloglucan endotransglycosylase in complex with the xyloglucan nonasaccharide XLLG. [Populus tremula],1UN1_A Xyloglucan endotransglycosylase native structure. [Populus tremula],1UN1_B Xyloglucan endotransglycosylase native structure. [Populus tremula]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WI46|CRF2_ASPFU	2.45e-21	24	306	8	282	Probable glycosidase crf2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=crf2 PE=1 SV=1
sp|Q05790|CRR1_YEAST	1.91e-16	124	325	158	351	Probable glycosidase CRR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRR1 PE=2 SV=1
sp|Q8LF99|XTH6_ARATH	5.33e-13	153	285	70	201	Probable xyloglucan endotransglucosylase/hydrolase protein 6 OS=Arabidopsis thaliana OX=3702 GN=XTH6 PE=2 SV=2
sp|Q8LDS2|XTH27_ARATH	7.74e-13	150	284	63	199	Probable xyloglucan endotransglucosylase/hydrolase protein 27 OS=Arabidopsis thaliana OX=3702 GN=XTH27 PE=2 SV=2
sp|Q9SV61|XTH1_ARATH	1.00e-12	131	284	40	201	Putative xyloglucan endotransglucosylase/hydrolase protein 1 OS=Arabidopsis thaliana OX=3702 GN=XTH1 PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000292	0.999679	CS pos: 40-41. Pr: 0.9664

TMHMM  Annotations     

There is no transmembrane helices in AMAG_18874-t26_1-p1.