CAZyme Information: AMAG_17712-t26_1-p1

Basic Information

• Species: Allomyces macrogynus
• Lineage: Blastocladiomycota; Blastocladiomycetes; ; Blastocladiaceae; Allomyces; Allomyces macrogynus
• CAZyme ID: AMAG_17712-t26_1-p1
• CAZy Family: GT57
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
753	GG745328|CGC1	84841.19	8.2449

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AmacrogynusATCC38327	19333	578462	535	18798

• Gene Location: location=GG745328:2461799-2464378(-)

Full Sequence      

MGSKSGLRHRKPQNDEQQPLLEVDTNGKASKPTSHAAAPAPAATESRALGNLLLWVATLA
SFVTRFYAISFPSQVVFDEVHFGKFASYYLRRTFYFDVHPPLGRLLIAAAGWVIGYDGHF
DFTNIGDDYIENKVPYIELRAWPALCGALVVPLVFEILRELRFSLQACFLGAMLVVLDNS
LVAQSRLILLDSMLMLFMTLALYCWVKFSKQRHNAFSCAWWSWLAMTGISLGLVMGVKMV
GLFTVATIGIAVLVELWYLLDYRRTSMAQFANHFFARAVCLIAVPIALYLTWFYIHFAVL
TKTGPGDAFMSPNFQATLHGNKMSGRAELVVYGANVTLKHFDTGAFLHSHKDRYPLTYED
KRVSSQGQQVTGYPHNDTNNVWLVKPADPDQWATLLDAETPHVVVKHNSIVVLEHLNTKT
HLLTHDVASPHTTTNQEFTTIPEEDWLNRLDETLFRVEIDGAADDEEPLKTLGVQFRLVH
VKTGVAMHTFKKPLPSWAYGQQEINGNKKKDEKSNKWLVEEVVYPTKAQAVPIDTAGEGL
KKPSFLKKFFELQGLMISHNAGLTKPHPYQSPPQNWPLVLTGISFWQDSVDKQIYLLPNP
VAWWVTLALIGVYAMGWVFERVAERRGVPVNDPKTANQVHFSIGFLFIAWALHYFPFFLM
GRSLFLHHYLPAAIIAFMVAGAMFDYVLTTMLPSLRKSATANIVAWIVTTACVAGIAAVF
WYYAPLTYGTTGLTVDELKARKWLQTWNFQYSG

Enzyme Prediction     

EC	2.4.1.109:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	57	297	6.2e-73	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	0.0	58	752	31	698	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
396786	PMT	2.39e-83	55	301	1	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
406576	PMT_4TMC	8.45e-66	547	744	1	197	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
397103	MIR	6.63e-17	338	515	3	183	MIR domain. The MIR (protein mannosyltransferase, IP3R and RyR) domain is a domain that may have a ligand transferase function.
224720	ArnT	4.61e-10	49	298	15	227	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBX95750.1|GT39	1.43e-228	1	744	54	809
ATZ46851.1|GT39	2.69e-227	51	744	50	761
CCD48541.1|GT39	2.69e-227	51	744	50	761
QSZ34493.1|GT39	3.28e-227	51	744	56	767
QIW96904.1|GT39	3.63e-227	21	744	17	770

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_A	2.02e-114	54	749	51	729	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_B	3.09e-105	58	748	72	752	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59X23|PMT4_CANAL	5.82e-198	54	744	51	747	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT4 PE=2 SV=2
sp|O42933|PMT4_SCHPO	7.05e-185	58	751	66	774	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm4 PE=3 SV=1
sp|P46971|PMT4_YEAST	1.21e-178	56	743	58	753	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT4 PE=1 SV=1
sp|Q9UKY4|POMT2_HUMAN	2.60e-129	53	749	60	750	Protein O-mannosyl-transferase 2 OS=Homo sapiens OX=9606 GN=POMT2 PE=1 SV=2
sp|Q8BGQ4|POMT2_MOUSE	4.90e-127	54	749	131	820	Protein O-mannosyl-transferase 2 OS=Mus musculus OX=10090 GN=Pomt2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999944	0.000051

TMHMM  Annotations     

Start	End
94	116
136	158
163	182
187	206
219	237
241	260
273	295
600	619
639	658
673	695
702	724