CAZyme Information: AMAG_16471-t26_1-p1

Basic Information

• Species: Allomyces macrogynus
• Lineage: Blastocladiomycota; Blastocladiomycetes; ; Blastocladiaceae; Allomyces; Allomyces macrogynus
• CAZyme ID: AMAG_16471-t26_1-p1
• CAZy Family: GT39
• CAZyme Description: alpha

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
915	GG745380|CGC1	98739.92	6.7676

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AmacrogynusATCC38327	19333	578462	535	18798

• Gene Location: location=GG745380:11258-14231(-)

Full Sequence      

MIGGTPSSTHSAAAALDAAAAPAPSTGGGRLLVVSNRLPVTLARDAESGEWKATMSSGGL
VSALSGLKRELEFTWIGWPGAVAGLTGAEQERVRQLLINEHRCVPVFLPEQIADLHYNGF
SNSILWPLLHYCPGEIAFREDQWDAYHAANVMFADAVLEHLQDGDMVWVQDYHLMLLPAL
LRAKCADQFPHIKLGFFLHTPFPSSEIYRILPVRREILLGILECDVVGFHTWDYARHFLS
SCTRILGLSTLPNGVEYEGRMVHVGTFPIGIDPDQFIAGLAKPAVQDRLATLRSKFQGVK
MIVGVDRLDYIKGVPLRLLAFEVFLSQHPEWIGKCVLVQVAVPSRTDVDEYQQLRSTVNE
LVGRINGQYGTVEFMPIHLLNKSVQFDELVALYAAADVCVVSSTRDGMNLVCGEYVAAQR
DGKGVLIMSEFAGAAQSLDGSILVNPWNTGRVGAGLPPGRDHGFANARREPRENVALRRV
GDELDLRMRMLPHLAPARVLASMSSSTGAAAVSPVSPVPLPRLAATKSKDLLLFAPMSPS
PTPSKSSTNSAATSLATARRMLRDHALRPFTAANLRVLFLDLGGTLTPGDRVLPDFAHPP
AHVLDLLYAAARLPNTAVYLMSGRARRHLGAWLARETEDVGIGVIAEHGCFFRHPPNRRR
MRAAVADPDGWVRLATHVDGAWRETIRPLFQHYTDRTPGSFIEDKEVNLSWHYRLGADPE
FGAWQAAELQVNVEKMLAHLPVTIVLGNKSLELRPANVDKASAVRSILRDLDALAAVEGQ
SNPSRYVLAVGDGKTDEVVFTYLAAGGGASTLATPAGTAHASPTGDDANRDSTVAAAAVS
AAATGQMNTAVTITVGKKQTAAKYFVDAVVDVHALLALLPMADADPALVAEDGEVKGSSV
RADAEAHRLPAQVAS

Enzyme Prediction     

EC	2.4.1.15:146

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	29	452	2.1e-180	0.88

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395781	Glyco_transf_20	0.0	29	452	1	426	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
215555	PLN03063	0.0	30	883	12	787	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
223457	OtsA	0.0	28	480	14	461	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].
215556	PLN03064	0.0	30	802	95	809	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
274112	trehalose_OtsA	0.0	30	449	1	409	alpha,alpha-trehalose-phosphate synthase [UDP-forming]. This enzyme catalyzes the key, penultimate step in biosynthesis of trehalose, a compatible solute made as an osmoprotectant in some species in all three domains of life. The gene symbol OtsA stands for osmotically regulated trehalose synthesis A. Trehalose helps protect against both osmotic and thermal stresses, and is made from two glucose subunits. This model excludes glucosylglycerol-phosphate synthase, an enzyme of an analogous osmoprotectant system in many cyanobacterial strains. This model does not identify archaeal examples, as they are more divergent than glucosylglycerol-phosphate synthase. Sequences that score in the gray zone between the trusted and noise cutoffs include a number of yeast multidomain proteins in which the N-terminal domain may be functionally equivalent to this family. The gray zone also includes the OtsA of Cornyebacterium glutamicum (and related species), shown to be responsible for synthesis of only trace amounts of trehalose while the majority is synthesized by the TreYZ pathway; the significance of OtsA in this species is unclear (see Wolf, et al., ). [Cellular processes, Adaptations to atypical conditions]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS08550.1|GT20	5.76e-287	30	803	15	730
AJA04606.1|GT20	2.86e-210	25	803	124	834
AGT80036.1|GT20	2.86e-210	25	803	124	834
QOX06485.1|GT20	1.86e-204	20	803	66	777
QRD82299.1|GT20	8.12e-204	25	449	8	429

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HVM_A	3.14e-203	30	449	13	429	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
6JBI_A	2.74e-201	30	449	1	417	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVO_A	7.21e-200	25	449	7	429	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HUT_A	2.28e-195	29	449	4	422	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
5HUV_A	1.82e-194	29	449	4	422	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54K57|TPSA_DICDI	3.67e-205	29	770	16	676	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1
sp|Q4WLM9|TPS1A_ASPFU	1.62e-202	30	449	13	429	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=tpsA PE=1 SV=1
sp|Q00075|TPS1A_ASPNG	9.82e-202	30	449	14	430	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 OS=Aspergillus niger OX=5061 GN=tpsA PE=1 SV=1
sp|P40387|TPS1_SCHPO	4.82e-201	30	449	20	436	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tps1 PE=1 SV=2
sp|O59921|TPS1_EMENI	9.93e-201	30	454	13	434	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=tpsA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999859	0.000181

TMHMM  Annotations     

There is no transmembrane helices in AMAG_16471-t26_1-p1.