CAZyme Information: AMAG_16227-t26_1-p1

Basic Information

• Species: Allomyces macrogynus
• Lineage: Blastocladiomycota; Blastocladiomycetes; ; Blastocladiaceae; Allomyces; Allomyces macrogynus
• CAZyme ID: AMAG_16227-t26_1-p1
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
840	GG745373|CGC5	93223.47	5.9737

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AmacrogynusATCC38327	19333	578462	535	18798

• Gene Location: location=GG745373:294476-297278(+)

Full Sequence      

MTRPPALAALVAAAVLAVVATLAAVPALATNDNASQHAHITGHHDSTIKDDPTLFWGTWR
PHLYFGLRTRAEDALLAGLMWFSTRDYNGLRDIRHTCEQHEELHYGYHVHDGREYALQHL
NDTANNLRFTTEVIKRPGGQHGGDWVARIRGEPLDPTQPMSTSFLFYAGLDGNGKGHGLP
TRDASGQHLLLNGESNELGEFSVFLCVDPKSAIPPPFSNPALGDQSWETPRFATFSLPKN
NVWKIKDLISKALLMGAQERAQAAQAAGYPPPPPAHIFALRDQPRENELGTVAQLSFEGP
FAFDVTFVSHSAHLGEEPRDVAHTYQKQADAWAQAGQAAFYDRFESTFQLRAKGFDSDHI
AMAQYALSNMLGGMGFFSGDSRINPAPENEADKFDWLYYWDPEEEGEQLADDDKKRRDAM
VRPGPTQTLFTATPSRPFFPRGFLWDEGFHQTLLQKWDQGLTMSVLQSWYALMDAEGWIA
REQILGDETRAKVPVEFHVQSTHIANPPTLLLAVQHLADTANKSAAAVAVPDPIHPGMPV
PLVGASAPAANASARLLAPFLADLLPRLVQHWEWFRSTQYGSATEYGRDLDNTEVYRWRG
RTARHNFASGLDDYPRADPPNIGELHVDLQAWMAWQARVLEELLARYPAADKDGTLLKRV
ASARHAAEANLRALFWSADDGVFADLTPNAYEDASVHAPHRGYVALLPFALQLLDPHADK
DAYTASLALVRELAAAGHGVRSLSPRDPAYGQGENYWRGAVWVNYNYLVLSALHKYGASD
PAAREVYDHVRKDVIRMVMDGFRATGFLYENYDGESGKPRGSHPFTGWTSLVVLIMAELY

Enzyme Prediction     

EC	3.2.1.106:25	3.2.1.-:4

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	9.65e-156	337	838	14	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
407154	Glyco_hydro_63N	6.40e-68	54	253	1	203	Glycosyl hydrolase family 63 N-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the N-terminal beta sandwich domain.
225942	GDB1	1.24e-08	556	834	356	600	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
236653	PRK10137	7.71e-06	747	840	698	777	alpha-glucosidase; Provisional
283786	GDE_C	1.89e-04	667	828	202	367	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS13455.1|GH63	3.38e-164	43	840	33	804
QRW14633.1|GH63	3.23e-153	80	840	1	744
QRV86063.1|GH63	3.23e-153	80	840	1	744
BCR88942.1|GH63	9.26e-153	50	837	36	801
QRW00106.1|GH63	2.77e-151	80	840	1	744

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MHF_A	1.59e-130	52	840	35	779	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]
4J5T_A	2.10e-106	53	838	14	802	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]
4WVA_A	6.83e-06	742	834	336	416	Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris [Thermus thermophilus HB8],4WVA_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris [Thermus thermophilus HB8],4WVB_A Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with glucose [Thermus thermophilus HB8],4WVB_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with glucose [Thermus thermophilus HB8],4WVC_A Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris and D-glycerate [Thermus thermophilus HB8],4WVC_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris and D-glycerate [Thermus thermophilus HB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q80UM7|MOGS_MOUSE	7.65e-131	52	840	90	834	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
sp|O14255|GCS1_SCHPO	8.76e-129	53	840	41	808	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
sp|Q13724|MOGS_HUMAN	1.97e-127	52	840	92	837	Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS PE=1 SV=5
sp|O88941|MOGS_RAT	2.31e-123	52	840	90	834	Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus OX=10116 GN=Mogs PE=1 SV=1
sp|P53008|CWH41_YEAST	1.78e-105	53	838	44	832	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.025177	0.974805	CS pos: 29-30. Pr: 0.9169

TMHMM  Annotations     

Start	End
7	29