CAZyme Information: AMAG_16207-t26_1-p1

Basic Information

• Species: Allomyces macrogynus
• Lineage: Blastocladiomycota; Blastocladiomycetes; ; Blastocladiaceae; Allomyces; Allomyces macrogynus
• CAZyme ID: AMAG_16207-t26_1-p1
• CAZy Family: GT33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
728	GG745373|CGC1	81282.33	9.1510

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AmacrogynusATCC38327	19333	578462	535	18798

• Gene Location: location=GG745373:237432-239949(+)

Full Sequence      

MSVLSGADTEARAMRVVILALIFAVAFSTRLFSVVRFESVIHEFDPWFNYRTTQKLVADG
FYEFWNWFDERSWYPLGRVVGGTVYPGLMVTAGVIHKLLHLINFPIDIRNVCVFLAPVFS
TLTSYAVYKLTAELHTRGAGLLAAGFMAIAPGYISRSVAGSYDNEGIAIFLLMYTFYLWI
KAVKIGSAFYGALAAAFYFYMVSAWGGYVFITNIVPLHAFVLVLMGRFSVRLYVAYTTWY
ALGTLASMQIPFVGFQPIRTSEHMAAMGIFGLLQLVAVVDFIRGHVSSKHFQTLLRIFVV
TVFLASVAALVALTAMGVVAPWTGRFYSLWDTSYAKKYIPIIASVSEHQPTAWPSFFFDL
HALVFLFPVGVYLCMQQLKDEHVFVVIYAVFASYFAGVMVRLMLTLTPIVCVASGIAVAT
LLQTYAAEPAADAEVTTGGKSGTGKPAASETSKIGIRAADAKWYVAIPVVALLAIYAWHC
TWVTSNAYSSPSIVLASRGHDGSQVIIDDFREAYYWLRKNTAPDARVMAWWDYGYQLAGM
ANRTTLVDNNTWNNTHIATVGKAMALPEDQAYDVMRALDVDYVLVIFGGLIGYSGDDINK
FLWMIRIAEGVYPSEVQEAKFFTDRGEYRIDDMAPPTMRHSLLYKLSYYRFADLFGGHSP
AYDRVRGTPITSKPITLHTVDEAYTTENWIVRIYQVKKPDNLGRSLKDASAFEAGTKRRV
RRKRAARA

Enzyme Prediction     

EC	2.4.99.18:21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT66	12	652	3.5e-183	0.8528138528138528

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396873	STT3	3.22e-138	16	489	4	478	Oligosaccharyl transferase STT3 subunit. This family consists of the oligosaccharyl transferase STT3 subunit and related proteins. The STT3 subunit is part of the oligosaccharyl transferase (OTase) complex of proteins and is required for its activity. In eukaryotes, OTase transfers a lipid-linked core-oligosaccharide to selected asparagine residues in the ER. In the archaea STT3 occurs alone, rather than in an OTase complex, and is required for N-glycosylation of asparagines.
224206	Stt3	7.16e-98	15	704	20	737	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].
404170	PMT_2	0.002	114	197	26	107	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS11103.1|GT66	0.0	14	719	13	730
CDS81882.1|GT66	0.0	14	719	36	777
SJX65712.1|GT66	0.0	14	719	39	779
CBQ70063.1|GT66	0.0	14	719	39	779
CCA70753.1|GT66	0.0	5	719	13	742

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6C26_A	5.84e-297	14	722	16	711	The Cryo-EM structure of a eukaryotic oligosaccharyl transferase complex [Saccharomyces cerevisiae S288C],6EZN_F Cryo-EM structure of the yeast oligosaccharyltransferase (OST) complex [Saccharomyces cerevisiae S288C],7OCI_F Chain F, Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 [Saccharomyces cerevisiae S288C]
6S7T_A	7.99e-292	18	701	76	777	Cryo-EM structure of human oligosaccharyltransferase complex OST-B [Homo sapiens]
6FTG_5	1.25e-275	14	705	18	703	Subtomogram average of OST-containing ribosome-translocon complexes from canine rough microsomal membranes [Canis lupus familiaris],6FTI_5 Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Programmed 80S Ribosome [Canis lupus familiaris]
6S7O_A	3.57e-275	14	705	18	703	Cryo-EM structure of human oligosaccharyltransferase complex OST-A [Homo sapiens]
6FTJ_5	8.52e-274	14	697	18	695	Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Non-programmed 80S Ribosome [Canis lupus familiaris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94335|STT3_SCHPO	5.27e-303	14	722	24	741	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit stt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=stt3 PE=3 SV=1
sp|P39007|STT3_YEAST	3.00e-296	14	722	16	711	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=STT3 PE=1 SV=2
sp|Q8TCJ2|STT3B_HUMAN	4.11e-291	18	701	76	777	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Homo sapiens OX=9606 GN=STT3B PE=1 SV=1
sp|E2RG47|STT3B_CANLF	1.17e-290	18	701	76	777	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Canis lupus familiaris OX=9615 GN=STT3B PE=1 SV=1
sp|Q3TDQ1|STT3B_MOUSE	3.01e-290	18	701	73	774	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Mus musculus OX=10090 GN=Stt3b PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000023	0.000002

TMHMM  Annotations     

Start	End
13	35
82	104
111	128
138	160
167	189
204	226
233	255
265	287
294	316
353	375
382	400
404	426
463	485