CAZyme Information: AMAG_16026-t26_1-p1

Basic Information

• Species: Allomyces macrogynus
• Lineage: Blastocladiomycota; Blastocladiomycetes; ; Blastocladiaceae; Allomyces; Allomyces macrogynus
• CAZyme ID: AMAG_16026-t26_1-p1
• CAZy Family: GT31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
440		47065.07	6.2838

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AmacrogynusATCC38327	19333	578462	535	18798

• Gene Location: location=GG745374:47042-48364(+)

Full Sequence      

MEAVPDAADIAVGTKTPPPTHQRQPTAGHRAGSVPASSGDARVAEPKVGKDPVRTGSDKS
HDHASRDSHVKSAPQSAVLMQAQQVAREHAARIEELTLAAAKRRQRTQPATTNIITETDA
AGTTSSDPPAWSTSTSNRIGLSCIPPLVHIMTKGVLDPQAAYCVDEWRRKNPGVSVLLWT
DDDMDAMVSVHAPYLLPLFRALPRGVLRADLFRYLVVATFGGVYADSDACPLKPLDQWLP
PVSLRADKGAGSAAAAVADGSSQTTAETPLIGNEDVALVIGMESDLATDDWYRFFARQLQ
LCQWTFAGVAGHPILTAIVAESVQRLRSKWAAGLGESGWPSITNEDVLDLTGPGVFTDVI
LAAWRAGKYQAAFEDLHYLTEPRRFGDAILLPIVAFSPGQPQPGSDRPGIVGDRNSPGAL
IRHLFLGSWRAEGDALRSST

Enzyme Prediction     

No EC number prediction in AMAG_16026-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	162	240	3.7e-19	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	6.47e-23	93	429	50	344	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.77e-16	162	240	6	88	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNQ01295.1|GT32	1.94e-43	167	439	145	391
AOW06798.1|GT32	1.94e-43	167	439	145	391
CAG77919.1|GT32|2.4.1.257	1.94e-43	167	439	145	391
CAD91643.1|GT32|2.4.1.257	1.94e-43	167	439	145	391
QSS75991.1|GT32	3.18e-39	167	434	126	370

PDB Hits     

AMAG_16026-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	6.65e-39	144	430	142	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	8.73e-33	167	433	127	379	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	8.20e-22	167	397	154	362	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	7.60e-20	171	434	129	474	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	3.32e-07	144	239	64	163	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000031	0.000003

TMHMM  Annotations     

There is no transmembrane helices in AMAG_16026-t26_1-p1.