CAZyme Information: AMAG_15319-t26_2-p1

Basic Information

• Species: Allomyces macrogynus
• Lineage: Blastocladiomycota; Blastocladiomycetes; ; Blastocladiaceae; Allomyces; Allomyces macrogynus
• CAZyme ID: AMAG_15319-t26_2-p1
• CAZy Family: GT2|GT2
• CAZyme Description: hypothetical protein, variant

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
504		56504.48	8.9989

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AmacrogynusATCC38327	19333	578462	535	18798

• Gene Location: location=GG745369:400754-402407(-)

Full Sequence      

MLHQPWVLYSEVSPVEHPPPYHVLRPETTRLFDYTMSYRLDSDFPIPPFGQDLVQAVETP
FNWYLVEQRFADTSRAPILWVSTVCKTDNRRSELVEQLQRLGLTVDSLGGCPTNGEQLPS
DTDLVKAMQKYKFVLVLETSNCHDYISRTFLRAIQAGSIPIVDGPKSYAAFLPHPDAAIQ
VDTYPTLADMAKELQHLAENQAAYSHRLQYRQDRRHWVQGWRDRWTSPRYAAGRRGGWCG
LCRHAIDAEQVLQHERERRAVYEASMDAKEAQLMQLVDALTVETAKLDGKPLVAAKAFER
DAQGKRIVRGARSLPLPRSFVPTPPRSRAAYVAPDYSCQLAKWAPTAFDPAAYRNVVPDD
YLRVLSTNVSRPTWPKPIRRRAHRASRLADLDGAVAAAEVRDREGSAAAAALFPLAPVMD
LRPDPLDGVDAPARPWTVLDWVLAVVVVVAGSVFVGVVRDRPKRGLADRMPLRRQSVVDP
ALLAKADSVPLRVMDGSSEHGKSR

Enzyme Prediction     

EC	2.4.1.214:5

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT10	3	249	2.3e-46	0.6714697406340058

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395683	Glyco_transf_10	4.56e-31	77	262	4	169	Glycosyltransferase family 10 (fucosyltransferase) C-term. This is the C-terminal domain of a family of fucosyltransferases. This enzyme transfers fucose from GDP-Fucose to GlcNAc in an alpha1,3 linkage. This family is known as glycosyltransferase family 10. The C-terminal domain is the likely binding-region for ADP (manuscript in publication).
407214	Glyco_tran_10_N	9.64e-06	3	47	68	107	Fucosyltransferase, N-terminal. This is the N-terminal domain of a family of fucosyltransferases. This enzyme transfers fucose from GDP-Fucose to GlcNAc in an alpha1,3 linkage. This family is known as glycosyltransferase family 10. The N-terminal domain is the likely binding-region for the fucose-like substrate (manuscript in publication).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS03884.1|GT10	7.42e-28	32	243	21	228
ACI33278.1|GT10	3.34e-20	3	211	155	370
CAB1337694.1|GT10	4.90e-20	3	215	155	374
CAI52077.1|GT10	3.21e-19	3	211	142	357
AHH38960.1|GT10	3.84e-19	1	211	121	338

PDB Hits     

AMAG_15319-t26_2-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5F2N2|FUT11_ORYLA	5.71e-20	3	211	142	357	Alpha-(1,3)-fucosyltransferase 11 OS=Oryzias latipes OX=8090 GN=fut11 PE=2 SV=1
sp|Q70AG8|FUT11_TAKRU	7.78e-20	3	215	146	365	Alpha-(1,3)-fucosyltransferase 11 OS=Takifugu rubripes OX=31033 GN=fut11 PE=2 SV=1
sp|Q9FX97|FUT12_ARATH	6.21e-19	30	211	185	354	Putative fucosyltransferase-like protein OS=Arabidopsis thaliana OX=3702 GN=FUT12 PE=2 SV=1
sp|Q8AWC7|FUT11_CHICK	1.91e-18	3	258	151	421	Alpha-(1,3)-fucosyltransferase 11 OS=Gallus gallus OX=9031 GN=FUT11 PE=2 SV=1
sp|Q08C60|FUT11_DANRE	7.33e-18	3	211	124	339	Alpha-(1,3)-fucosyltransferase 11 OS=Danio rerio OX=7955 GN=fut11 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000066	0.000000

TMHMM  Annotations     

Start	End
436	458