CAZyme Information: AMAG_15124-t26_1-p1

Basic Information

• Species: Allomyces macrogynus
• Lineage: Blastocladiomycota; Blastocladiomycetes; ; Blastocladiaceae; Allomyces; Allomyces macrogynus
• CAZyme ID: AMAG_15124-t26_1-p1
• CAZy Family: GT22
• CAZyme Description: glycogen/starch/alpha-glucan phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
671		76696.91	7.2768

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AmacrogynusATCC38327	19333	578462	535	18798

• Gene Location: location=GG745364:302886-304901(+)

Full Sequence      

MQTHTLRDPKRVYYMSLEFLLGRSLDNALLNLQLKNKYGQALNSLGFNLEDLIQEEDDAA
LGNGGLGRLAACYMDSLACLEYPAWGYGLRYTYGIFKQRIVDGHQTEFPDYWLNFGNPWE
VPRLDVVYEVRFYGQCHKYVDADGSVRWKWDGGDKVQAVAYDVPIPGFNNQTCLNIRLWS
SKPKKQFDLGLFNEGNYDKSVEEQQRAENITSVLYPNDNHMVGKELRLKQQYFFVCATLK
DVIRRFKKTNRPWADFPDQVAVQLNDTHPTLGIVELQRRLVDIEGLEWDEAWEIVTRVFA
FTNHTVLPEALETWPVPMMAHLLPRHLAIIYDINLFFLQKVEAMFPNDRDRLRRMSIIEE
SSPQRVRMAHLAIVGSHCVNGVAALHSELVKNVIFKDFVDFYGADKFTNVTNGITPRRWL
NQANPQLASLITATIGDGWSKDLTELAKLKAHADKPDFQKKWMAIKKHNKQRLADLIRKQ
SGIVVDPESLFDVQVKRIHEYKRQLMNILGVIHRYLALKRMTPAARANEVKRTVIFGGKA
APGYYMAKLVIKLINNVANIVNNDPQTRDYLKVVYIFDYNVSLAEIIIPASDISQHISTA
GTEASGTSNMKFVLNGGLIVGTVDGANIEIGEEIGDENIFFFGALAHEVDDIRHAQRYRQ
VKMDAHLEVVL

Enzyme Prediction     

EC	2.4.1.1:158

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT35	41	662	1.5e-254	0.8590504451038575

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395272	Phosphorylase	0.0	42	654	1	557	Carbohydrate phosphorylase. The members of this family catalyze the formation of glucose 1-phosphate from one of the following polyglucoses; glycogen, starch, glucan or maltodextrin.
184948	PRK14986	0.0	7	653	67	704	glycogen phosphorylase; Provisional
223136	GlgP	0.0	8	670	60	656	Glucan phosphorylase [Carbohydrate transport and metabolism].
237881	PRK14985	0.0	10	671	59	710	maltodextrin phosphorylase; Provisional
273967	P_ylase	0.0	2	654	42	689	glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNQ01362.1|GT35	0.0	2	670	128	796
AOW06640.1|GT35	0.0	2	670	128	796
CAG77789.1|GT35	0.0	2	670	128	796
UKZ73690.1|GT35	0.0	2	670	123	792
UKZ47118.1|GT35	0.0	2	670	123	792

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1YGP_A	1.37e-290	2	671	89	788	Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site. [Saccharomyces cerevisiae],1YGP_B Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site. [Saccharomyces cerevisiae]
3CEH_A	5.88e-239	9	652	57	696	Human liver glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE5688 [Homo sapiens],3CEH_B Human liver glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE5688 [Homo sapiens],3CEJ_A Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE2865 [Homo sapiens],3CEJ_B Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE2865 [Homo sapiens],3CEM_A Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE9423 [Homo sapiens],3CEM_B Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE9423 [Homo sapiens]
1FA9_A	1.98e-238	9	652	79	718	HUMAN LIVER GLYCOGEN PHOSPHORYLASE A COMPLEXED WITH AMP [Homo sapiens]
1FC0_A	1.98e-238	9	652	79	718	HUMAN LIVER GLYCOGEN PHOSPHORYLASE COMPLEXED WITH N-ACETYL-BETA-D-GLUCOPYRANOSYLAMINE [Homo sapiens],1FC0_B HUMAN LIVER GLYCOGEN PHOSPHORYLASE COMPLEXED WITH N-ACETYL-BETA-D-GLUCOPYRANOSYLAMINE [Homo sapiens],2ATI_A Glycogen Phosphorylase Inhibitors [Homo sapiens],2ATI_B Glycogen Phosphorylase Inhibitors [Homo sapiens]
1XOI_A	1.98e-238	9	652	79	718	Human Liver Glycogen Phosphorylase A complexed with Chloroindoloyl glycine amide [Homo sapiens],1XOI_B Human Liver Glycogen Phosphorylase A complexed with Chloroindoloyl glycine amide [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q00766|PHS1_DICDI	5.72e-305	2	670	89	756	Glycogen phosphorylase 1 OS=Dictyostelium discoideum OX=44689 GN=glpV PE=1 SV=3
sp|P06738|PHSG_YEAST	9.43e-291	2	671	112	811	Glycogen phosphorylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPH1 PE=1 SV=4
sp|P34114|PHS2_DICDI	1.01e-268	7	653	164	805	Glycogen phosphorylase 2 OS=Dictyostelium discoideum OX=44689 GN=glpD PE=1 SV=2
sp|O84250|PHSG_CHLTR	1.98e-245	8	653	64	704	Glycogen phosphorylase OS=Chlamydia trachomatis (strain D/UW-3/Cx) OX=272561 GN=glgP PE=3 SV=1
sp|Q9PKE6|PHSG_CHLMU	1.09e-244	8	654	64	705	Glycogen phosphorylase OS=Chlamydia muridarum (strain MoPn / Nigg) OX=243161 GN=glgP PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000000

TMHMM  Annotations     

There is no transmembrane helices in AMAG_15124-t26_1-p1.