CAZyme Information: AMAG_14693-t26_2-p1

Basic Information

• Species: Allomyces macrogynus
• Lineage: Blastocladiomycota; Blastocladiomycetes; ; Blastocladiaceae; Allomyces; Allomyces macrogynus
• CAZyme ID: AMAG_14693-t26_2-p1
• CAZy Family: GT21
• CAZyme Description: hypothetical protein, variant

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
331		36990.59	9.6176

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AmacrogynusATCC38327	19333	578462	535	18798

• Gene Location: location=GG745366:433498-434732(-)

Full Sequence      

MLGIASDGLTYRHDHALAFFPAMPWLARVVARYVLDPLFGSSRSGSDADANDERLLLAWG
GIVVANLAFLAASAALFGLVCTVTKRPHRAFLAAVLFACQPASVFMSSFYTEPVFAFLAF
SGMWAMEQSYWALAALLWALSTLVRSNGILHTGFFAYHFLFVKVRLVVRVVVRISAPVLT
FLPRPRSLGFDLLSYTPPTWCATRPLDVPTLGTPHLPVHGLPYTAVQAQYWHVGWLRYWS
LAQLPNFAFAAPVLVHSIVQIVNARDWPVPYRVLHAFCVFYGLTSMHVQVVVRMFSCLPL
MFLTESRRWVLYSVLWATVGAILFGLFYPPA

Enzyme Prediction     

No EC number prediction in AMAG_14693-t26_2-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	10	331	9.3e-62	0.8329238329238329

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	8.19e-25	11	331	73	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	1.03e-10	90	331	148	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS09540.1|GT76	1.21e-33	4	331	64	392
ACO67127.1|GT76	1.63e-23	4	329	68	419
BBN03197.1|GT76	3.16e-22	4	261	92	341
QHO38400.1|GT76	1.36e-20	11	262	95	340
AFP03398.1|GT76	1.72e-20	2	285	63	367

PDB Hits     

AMAG_14693-t26_2-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9NUD9|PIGV_HUMAN	1.64e-19	2	255	72	336	GPI mannosyltransferase 2 OS=Homo sapiens OX=9606 GN=PIGV PE=1 SV=1
sp|Q6C216|GPI18_YARLI	1.68e-19	53	331	83	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1
sp|Q5KR61|PIGV_RAT	2.98e-19	2	267	72	351	GPI mannosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Pigv PE=2 SV=1
sp|Q7TPN3|PIGV_MOUSE	6.03e-18	2	255	72	336	GPI mannosyltransferase 2 OS=Mus musculus OX=10090 GN=Pigv PE=2 SV=2
sp|Q09712|GPI18_SCHPO	4.17e-14	95	331	207	464	GPI mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpi18 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998051	0.001944

TMHMM  Annotations     

Start	End
57	79
91	110
130	149
236	258
273	295
308	330