CAZyme Information: AMAG_14693-t26_1-p1

Basic Information

• Species: Allomyces macrogynus
• Lineage: Blastocladiomycota; Blastocladiomycetes; ; Blastocladiaceae; Allomyces; Allomyces macrogynus
• CAZyme ID: AMAG_14693-t26_1-p1
• CAZy Family: GT21
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
334	GG745366|CGC3	37656.28	9.2765

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AmacrogynusATCC38327	19333	578462	535	18798

• Gene Location: location=GG745366:433498-434732(-)

Full Sequence      

MLGIASDGLTYRHDHALAFFPAMPWLARVVARYVLDPLFGSSRSGSDADANDERLLLAWG
GIVVANLAFLAASAALFGLVCTVTKRPHRAFLAAVLFACQPASVFMSSFYTEPVFAFLAF
SGMWAMEQSYWALAALLWALSTLVRSNGILHTGFFAYHFLFVKPRFRFIMYAAVVFAPFL
WWQLVSWHRFCTPPTVAYTPPTWCATRPLDVPTLGTPHLPVHGLPYTAVQAQYWHVGWLR
YWSLAQLPNFAFAAPVLVHSIVQIVNARDWPVPYRVLHAFCVFYGLTSMHVQVVVRMFSC
LPLMFLTESRRWVLYSVLWATVGAILFGLFYPPA

Enzyme Prediction     

No EC number prediction in AMAG_14693-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	10	334	1.6e-67	0.8329238329238329

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	1.66e-30	11	334	73	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	2.54e-11	90	334	148	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS09540.1|GT76	6.74e-34	4	334	64	392
ACO67127.1|GT76	4.98e-29	4	332	68	419
QHO38400.1|GT76	5.62e-25	11	265	95	340
QHO07244.1|GT76	1.44e-24	11	268	95	346
BBN03197.1|GT76	8.17e-24	4	264	92	341

PDB Hits     

AMAG_14693-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6C216|GPI18_YARLI	3.52e-23	53	334	83	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1
sp|Q9NUD9|PIGV_HUMAN	1.16e-22	2	258	72	336	GPI mannosyltransferase 2 OS=Homo sapiens OX=9606 GN=PIGV PE=1 SV=1
sp|Q5KR61|PIGV_RAT	7.26e-22	2	270	72	351	GPI mannosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Pigv PE=2 SV=1
sp|Q7TPN3|PIGV_MOUSE	1.13e-20	2	258	72	336	GPI mannosyltransferase 2 OS=Mus musculus OX=10090 GN=Pigv PE=2 SV=2
sp|P0CP63|GPI18_CRYNB	4.74e-18	4	334	60	423	GPI mannosyltransferase 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998051	0.001944

TMHMM  Annotations     

Start	End
168	185
242	264
276	298
313	332
57	79
91	110
130	161