CAZyme Information: AMAG_13276-t26_1-p1

Basic Information

• Species: Allomyces macrogynus
• Lineage: Blastocladiomycota; Blastocladiomycetes; ; Blastocladiaceae; Allomyces; Allomyces macrogynus
• CAZyme ID: AMAG_13276-t26_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
533		56206.70	9.6182

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AmacrogynusATCC38327	19333	578462	535	18798

• Gene Location: location=GG745355:555357-557114(-)

Full Sequence      

MTPINPFTITTALLLAIATVATPALAAPAQCTSLATVTVTVPTTVTVTVPAPVAPTATPT
SATTIAKPTSATTIAKPTSAVTIPPSVPSATIPKSAPAATSTPTAPAAPPAQWKTITKNG
VGTDSGMWYSLWTDSPGHASLIVGPDGQYKTTWNEVGDVVAGKGWPTGSLTRVVGYSGTF
SPQGSGFLSLYGWTKDWTVEYAISDNWGNYRPTGEFRGTLVSDGDTYDIYQVFRKDASPS
GGKFQNYMSVRRNKRSSGTITFANHVKAWASHGMPLGPLGVQFLATEGYKSSGSSSINVW
EVTGPAPVTTIGTPTSVATIPKSTPAATGTPAAPAAPPAEWKTISKNGSGYELGGLWYSF
WADVPGHSSISIGPDGQYTTSWNGVSNFVAGKGWPTGSTTRVVSYSGTFSPQGNGYLSVY
GWAKDWSVEYYITDNWGNYRPTGEFRGTLVSDGDTYDIYQVFRQDPSPSGGKFQQYWSVR
RNRRSSGTITIGNHFKAWASHGMKLGALGVQFVATEGYKSSGSSSITVREVHA

Enzyme Prediction     

EC	3.2.1.8:104	3.2.1.8:104

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH11	355	527	1.1e-58	0.9887005649717514
GH11	126	297	2.8e-53	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395367	Glyco_hydro_11	7.35e-71	354	525	1	175	Glycosyl hydrolases family 11.
395367	Glyco_hydro_11	9.14e-62	125	296	1	175	Glycosyl hydrolases family 11.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLK00118.1|GH11	8.97e-69	343	528	46	235
ABF02144.1|GH11|3.2.1.8	1.09e-68	344	528	2	187
ACR92598.1|GH11	1.42e-68	343	528	42	227
AAD54767.1|CBM2|GH11|3.2.1.8	6.96e-68	344	528	45	229
AAF04601.1|CBM2|GH11	2.71e-67	343	528	42	227

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1M4W_A	2.96e-68	343	530	3	190	Thermophilic b-1,4-xylanase from Nonomuraea flexuosa [Thermopolyspora flexuosa]
3ZSE_A	9.40e-68	344	528	2	186	3D Structure of a thermophilic family GH11 xylanase from Thermobifida fusca [Thermobifida fusca]
7EO6_A	1.09e-67	343	528	5	190	Chain A, Endo-1,4-beta-xylanase [Actinomycetia bacterium],7EO6_B Chain B, Endo-1,4-beta-xylanase [Actinomycetia bacterium]
7DFM_A	2.50e-65	355	528	15	190	Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 [Streptomyces olivaceoviridis],7DFM_B Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 [Streptomyces olivaceoviridis],7DFM_C Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 [Streptomyces olivaceoviridis],7DFM_D Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 [Streptomyces olivaceoviridis],7DFN_A Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with alpha-L-arabinofuranosyl xylotetraose [Streptomyces olivaceoviridis],7DFN_B Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with alpha-L-arabinofuranosyl xylotetraose [Streptomyces olivaceoviridis],7DFN_C Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with alpha-L-arabinofuranosyl xylotetraose [Streptomyces olivaceoviridis],7DFN_D Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with alpha-L-arabinofuranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_A Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_B Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_C Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_D Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_E Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_F Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_G Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_H Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_I Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis]
5EJ3_A	3.46e-64	355	528	55	230	Crystal structure of XlnB2 [Streptomyces lividans],5EJ3_B Crystal structure of XlnB2 [Streptomyces lividans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D7EZJ3|XYNB_STRSQ	3.27e-66	337	528	46	239	Endo-1,4-beta-xylanase B OS=Streptomyces sp. OX=1931 GN=xynBS9 PE=1 SV=1
sp|P26515|XYNB_STRLI	3.70e-62	355	528	55	230	Endo-1,4-beta-xylanase B OS=Streptomyces lividans OX=1916 GN=xlnB PE=1 SV=3
sp|Q9RI72|XYNC_STRCO	7.63e-60	343	528	52	239	Endo-1,4-beta-xylanase C OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) OX=100226 GN=xlnC PE=3 SV=1
sp|P26220|XYNC_STRLI	2.18e-58	343	528	52	238	Endo-1,4-beta-xylanase C OS=Streptomyces lividans OX=1916 GN=xlnC PE=1 SV=1
sp|P55330|XYNB_ASPNG	1.05e-57	352	529	45	225	Endo-1,4-beta-xylanase B OS=Aspergillus niger OX=5061 GN=xlnB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000249	0.999738	CS pos: 26-27. Pr: 0.9775

TMHMM  Annotations     

There is no transmembrane helices in AMAG_13276-t26_1-p1.