CAZyme Information: AMAG_12683-t26_1-p1

Basic Information

• Species: Allomyces macrogynus
• Lineage: Blastocladiomycota; Blastocladiomycetes; ; Blastocladiaceae; Allomyces; Allomyces macrogynus
• CAZyme ID: AMAG_12683-t26_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
263		28578.56	6.4924

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AmacrogynusATCC38327	19333	578462	535	18798

• Gene Location: location=GG745357:164796-165664(+)

Full Sequence      

MDGLHVMTDSVIDKVVAVLVQINDMGVPVMLRFAHEMNGAWYAWGQKPDLYKSTWIKLTK
AVRAKAKLTSTVWAANVAAGYPWTDTYSPAKGSPDFVAMDTNKDGAVDAKDDPFAPYYPG
NDWVDWIGFSLFHFGPYPFGKNVVPESGAVAGVLEPATWSITQFASSMNKPFGVFEAGAV
YYPSGSGANDAVLDASIKTTWLSQIAAMSKGSSNHARISLLMWFEIAKIENSGQARDFAL
FKSNEVADKIKPMLKAGAFVNNA

Enzyme Prediction     

No EC number prediction in AMAG_12683-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	10	205	6.7e-26	0.47854785478547857

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226609	ManB2	1.54e-09	26	180	179	298	Beta-mannanase [Carbohydrate transport and metabolism].
396639	Glyco_hydro_26	1.70e-09	12	125	136	242	Glycosyl hydrolase family 26.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCW64234.1|GH26	7.83e-53	3	230	63	298
BCW15935.1|GH26	1.10e-52	3	248	63	317
BCW32807.1|GH26	1.10e-52	3	248	63	317
BCW28536.1|GH26	1.10e-52	3	248	63	317
BCW24268.1|GH26	1.10e-52	3	248	63	317

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7EET_A	4.08e-08	10	178	161	288	Chain A, Mannanase KMAN [Klebsiella oxytoca]
6Q75_A	4.13e-07	12	133	153	253	The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
2WHK_A	1.80e-06	9	132	140	242	Structure of Bacillus subtilis mannanase man26 [Bacillus subtilis]
2QHA_A	1.83e-06	9	132	140	242	From Structure to Function: Insights into the Catalytic Substrate Specificity and Thermostability Displayed by Bacillus subtilis mannanase BCman [Bacillus subtilis],2QHA_B From Structure to Function: Insights into the Catalytic Substrate Specificity and Thermostability Displayed by Bacillus subtilis mannanase BCman [Bacillus subtilis]
3CBW_A	1.87e-06	9	132	149	251	Chain A, YdhT protein [Bacillus subtilis],3CBW_B Chain B, YdhT protein [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P55278|MANB_BACIU	8.90e-08	9	186	164	296	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis OX=1423 PE=3 SV=1
sp|O05512|MANB_BACSU	9.81e-06	9	132	166	268	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuG PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000036	0.000000

TMHMM  Annotations     

There is no transmembrane helices in AMAG_12683-t26_1-p1.