CAZyme Information: AMAG_12087-t26_1-p1

Basic Information

• Species: Allomyces macrogynus
• Lineage: Blastocladiomycota; Blastocladiomycetes; ; Blastocladiaceae; Allomyces; Allomyces macrogynus
• CAZyme ID: AMAG_12087-t26_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
368	GG745353|CGC2	40134.25	6.6545

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AmacrogynusATCC38327	19333	578462	535	18798

• Gene Location: location=GG745353:842102-843518(+)

Full Sequence      

MFARAFARAVTRTATPRPATTNAIRAAALRRAALSTAAPSGGSSKIPIAIALIAASAGAY
YYGVQSYPAIKQSAEQAKADKAAAAAEEEAPKEPEPLDYRKVAADIAELLDDVDYDDGSY
GPVFVRLAWHASGTYNKADGTGGSNGATMRFSPEAADGANAGLDVARNRLEPIKAKYPQI
SYADLWTLAGVVAIKEMGGPSIPWKAGRTDAVSAAACPPQGRLPDASKDRKHVREVFNRM
GFDDREIVALMGAHVLGRCHPDRSGYHLPWTYNPTTFTNAYYTLLQSESWKKEKNWDGPM
QYTNKKGSGDIMMLPTDMEMLWDRTFKQYVKEFANDEQAWFDAFSSAFKKLLELGVQFPA
EAQDIVLE

Enzyme Prediction     

No EC number prediction in AMAG_12087-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	102	356	6.4e-63	0.9803921568627451

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173825	ascorbate_peroxidase	1.40e-137	98	359	12	253	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
178218	PLN02608	4.04e-77	122	362	32	250	L-ascorbate peroxidase
223453	KatG	3.56e-69	97	362	67	423	Catalase (peroxidase I) [Inorganic ion transport and metabolism].
178467	PLN02879	5.74e-64	121	355	34	246	L-ascorbate peroxidase
166005	PLN02364	2.51e-61	121	355	33	246	L-ascorbate peroxidase 1

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKY15243.1|AA2	2.91e-114	98	362	107	368
QRD85779.1|AA2	1.41e-112	94	367	86	357
QMW29426.1|AA2	1.41e-112	94	367	86	357
QMW41498.1|AA2	1.41e-112	94	367	86	357
UDD58631.1|AA2	1.41e-112	94	367	86	357

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1JCI_A	1.40e-80	98	362	18	280	Chain A, Cytochrome C Peroxidase [Saccharomyces cerevisiae]
1JDR_A	3.17e-79	98	362	18	280	Chain A, Cytochrome c Peroxidase [Saccharomyces cerevisiae]
2V2E_A	6.33e-79	98	362	18	280	Structure of isoniazid (INH) bound to cytochrome c peroxidase mutant N184R Y36A [Saccharomyces cerevisiae]
2V23_A	6.74e-79	98	362	20	282	Structure of cytochrome c peroxidase mutant N184R Y36A [Saccharomyces cerevisiae],4A6Z_A Cytochrome c peroxidase with bound guaiacol [Saccharomyces cerevisiae]
4A71_A	9.53e-79	98	362	20	282	cytochrome c peroxidase in complex with phenol [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WPF8|CCPR_ASPFU	6.21e-115	94	364	90	358	Cytochrome c peroxidase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=ccp1 PE=3 SV=1
sp|A4QVH4|CCPR_MAGO7	2.45e-108	4	358	10	346	Cytochrome c peroxidase, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=CCP1 PE=3 SV=1
sp|P0C0V3|CCPR_EMENI	1.91e-107	94	364	85	353	Cytochrome c peroxidase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ccp1 PE=3 SV=1
sp|Q7SDV9|CCPR_NEUCR	2.58e-104	98	363	86	349	Cytochrome c peroxidase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=ccp-1 PE=3 SV=1
sp|Q6URB0|CCPR_CRYNH	1.09e-102	98	356	106	361	Cytochrome c peroxidase, mitochondrial OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CCP1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999449	0.000533

TMHMM  Annotations     

There is no transmembrane helices in AMAG_12087-t26_1-p1.