CAZyme Information: AMAG_11866-t26_1-p1

Basic Information

• Species: Allomyces macrogynus
• Lineage: Blastocladiomycota; Blastocladiomycetes; ; Blastocladiaceae; Allomyces; Allomyces macrogynus
• CAZyme ID: AMAG_11866-t26_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
520	GG745353|CGC1	58900.08	7.2547

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AmacrogynusATCC38327	19333	578462	535	18798

• Gene Location: location=GG745353:241566-243565(-)

Full Sequence      

MFRKGWNGYLRHGFPHDDLAALSCTGRKSQGEYYLTLIDSADTLAMMGLMEPFAKTIQLI
TTVLPNFDLNVNVSLFETNIRILGGLVSSHLIATEKLPAYRGELLPLARDLGNRFLPAFN
TRTGIPYGTVNLRHGVPPAETPVVCTACAGSLLLEMGTLSHLTGDPRYYNAAKRALVEVW
NRRSYLDLLGNHLDSQSGVWTATTSGIAGAIDSLYEYLWKAYTVFHDNDLYDMFVQAYQA
IETHGTRDGWHVPVEMNTGDTGSSTFANLQCFWAGYQASFGELVKSTIMVQRMAHLTNQF
AFLPELLNIRTWTLTGHADNPLRPELVESVYFLYQAVKEPGLQEFGFELLKRFYEKAQTQ
CGFASIAHVESLYKNDHMESFFLAESLKYLYLLFDPSNDFNTGSWIYTTEAHPVRVLVNR
LRPKWDIPRPRPIPPLRPPRDHPDASPRVRWAHQACDAREWRYVRDHLAWSKPYTGVNWV
RHWPNVVPPEGIDMLRRAADAGRDRRPVGAGGMLNVTGAW

Enzyme Prediction     

EC	3.2.1.113:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	1	415	9.1e-121	0.9955156950672646

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	2.81e-118	1	416	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	1.76e-73	1	416	79	518	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAD7091191.1|GH47	1.49e-111	1	414	56	494
CAD7263580.1|GH47	2.73e-111	1	414	8	446
CAD7202732.1|GH47	1.05e-110	1	414	43	481
CAD7275460.1|GH47	8.92e-109	1	418	11	428
AJA37857.1|GH47	3.01e-107	1	414	44	484

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KIJ_A	7.65e-52	1	416	12	451	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	8.69e-52	1	416	17	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	9.07e-52	1	416	17	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
1X9D_A	4.13e-51	1	416	95	534	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]
5KK7_A	4.24e-51	1	416	12	451	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9BV94|EDEM2_HUMAN	3.82e-102	1	414	42	480	ER degradation-enhancing alpha-mannosidase-like protein 2 OS=Homo sapiens OX=9606 GN=EDEM2 PE=1 SV=2
sp|Q9FG93|MNS4_ARATH	1.31e-101	1	412	47	469	Alpha-mannosidase I MNS4 OS=Arabidopsis thaliana OX=3702 GN=MNS4 PE=1 SV=1
sp|Q8BJT9|EDEM2_MOUSE	5.76e-101	1	414	42	480	ER degradation-enhancing alpha-mannosidase-like protein 2 OS=Mus musculus OX=10090 GN=Edem2 PE=1 SV=1
sp|Q9SXC9|MNS5_ARATH	3.02e-92	1	417	44	479	Alpha-mannosidase I MNS5 OS=Arabidopsis thaliana OX=3702 GN=MNS5 PE=1 SV=1
sp|Q925U4|EDEM1_MOUSE	3.90e-87	1	416	132	581	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Mus musculus OX=10090 GN=Edem1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000037	0.000000

TMHMM  Annotations     

There is no transmembrane helices in AMAG_11866-t26_1-p1.