CAZyme Information: AMAG_10694-t26_1-p1

Basic Information

• Species: Allomyces macrogynus
• Lineage: Blastocladiomycota; Blastocladiomycetes; ; Blastocladiaceae; Allomyces; Allomyces macrogynus
• CAZyme ID: AMAG_10694-t26_1-p1
• CAZy Family: GT10
• CAZyme Description: alpha

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1023	GG745346|CGC1	109162.62	6.4641

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AmacrogynusATCC38327	19333	578462	535	18798

• Gene Location: location=GG745346:440482-443630(+)

Full Sequence      

MGIITVLRRLSLSSSGRSSSGNSRRRRSSSGDPASRARARSPLSASSSSPDVLASTDENT
GSISLRTPSSTMATVPEVVANDGKHAPADDSCPQPTNTPASPAPTPTPHAALDATPATPA
SAPAIETASPAVSAPAPTDAEPVPAVAPTNGVAASPSVIAKDLPAPPKATLPPVPPPATT
PAAATSELANGARLLVVSNRLPVTLAQDATTGSWTARMSSGGLVSALSGLKKDMAFTWIG
WPGKDFPADDQVRIADMLARVHRCVPVFLPDDIADAHYNGFSNSILWPLFHYHPGDMAFN
EAHWAAYHAANMAFADAIMATLQDGDIVWVHDYHLMLLPQMLRLQCDARGLRNVKIGFFL
HTPFPTSEVYRILPVRREMLLGLLQCDLVGFHTYDYARHFLSSCTQILGLATMPNGVDHE
GRFVHVGAFPIGIDPDQFVAALDTDAVRERVAHLRDRFAGTKVIVGVDRLDYIKGVPHKL
HALKVFLDGHPEWIGKVVLIQVAVPSRSDVDEYQHLRATVNELVGRINGEYGTVEAMPIH
YLHQSVSFTELVALYAVADVCVVSSTRDGMNLVSYEYIAAQRDAHGVLIMSEFAGAAQSL
NGALLVNPWNTEELADAYAAALAMPAAERANNHAKLFRYVAKHTAAYWGHTFVHELLRFT
DANGPSAARHPAKLAPARFLANVAPSAPPANDRAPSPTASHFSTTTATNGGTDPLRSSVL
RAFVSAPQRVLFLDQGGTLASEHLRPEFSAPPPNVIAALRDLAAVPNTAIYIVSGRARRH
LAAWYADVAVGLSAEHGCFYRHARDSHIESKMAETDADGWVALAHHVDLAWRDTVRPLFD
HYTERTPGSYVEDKEVAFTWNYRDTDAEFGAWQANELQVNVEKMLSHLPVSIIPGGNKTL
ELRPSAIDKASAVRAILADVGAKPGAFVMSVGNGMSDEAVFACVANAAKDAVTVTVGKKS
SAAKYYVDGISDVHALLDALVVAAKDPALVADDEDVPVCAAAAGKARHDVPAVPELPALA
MAE

Enzyme Prediction     

EC	2.4.1.15:146

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	184	656	8e-200	0.9852631578947368

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223457	OtsA	0.0	190	656	13	477	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].
184712	PRK14501	0.0	192	981	1	724	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
215555	PLN03063	0.0	193	984	12	787	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
215556	PLN03064	0.0	193	971	95	838	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
340820	GT20_TPS	0.0	193	656	1	462	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS08550.1|GT20	0.0	183	980	2	765
AJA04606.1|GT20	3.88e-231	191	985	127	881
AGT80036.1|GT20	3.88e-231	191	985	127	881
AEO59700.1|GT20	1.18e-222	181	663	3	483
UNI17530.1|GT20	1.67e-222	181	670	2	490

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HVM_A	6.04e-219	190	674	10	492	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
6JBI_A	1.84e-214	193	658	1	464	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVO_A	8.64e-214	193	658	12	476	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HUT_A	1.06e-211	193	658	5	469	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
5HUV_A	3.39e-210	193	658	5	469	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54K57|TPSA_DICDI	6.41e-223	186	977	10	731	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1
sp|Q07158|TPS1_KLULA	2.87e-222	194	663	18	487	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 56 kDa subunit OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=TPS1 PE=1 SV=1
sp|P40387|TPS1_SCHPO	1.81e-219	185	669	12	494	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tps1 PE=1 SV=2
sp|Q00075|TPS1A_ASPNG	4.17e-219	181	661	2	480	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 OS=Aspergillus niger OX=5061 GN=tpsA PE=1 SV=1
sp|Q00764|TPS1_YEAST	5.36e-219	182	668	6	492	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 56 kDa subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000035	0.000005

TMHMM  Annotations     

There is no transmembrane helices in AMAG_10694-t26_1-p1.