CAZyme Information: AMAG_10360-t26_1-p1

Basic Information

• Species: Allomyces macrogynus
• Lineage: Blastocladiomycota; Blastocladiomycetes; ; Blastocladiaceae; Allomyces; Allomyces macrogynus
• CAZyme ID: AMAG_10360-t26_1-p1
• CAZy Family: GH72
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
582	GG745349|CGC2	61955.47	5.6953

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AmacrogynusATCC38327	19333	578462	535	18798

• Gene Location: location=GG745349:423878-425873(+)

Full Sequence      

MSPSPAASRCDHDPRSRSTQLLPRRVLFAALFMLATLLLLASPPRVVHGGPMPEPGPIPA
DPVAPMGGPPPLVIRSNHFFDPSTGQRFAIKGVSYQPRYRGDVIDPISNAQRTAWERDLP
VLASLGANVVRVYDIDAAAPHDQFMAALAERNMYLLLDMASAKSPLHHVDRSDPHLTVDL
LDRYLRIVDAFAGYDNVLGFLIGNEVSDSAGPSTRSAAIVRALVRDVRQYIKVTGKRAIP
LGYAASDNAATRTPNMQFYTCGAKDSAVDFYGANIYSWCAANQTFETSGYVDRTKELASL
GVPVLLSEFGCNIITPRTFPDVSSIYGPDMDAVVDGAIAYEYTEEDNRYGLVQVASASDT
RVTLLKDYENLKNQWSAAKPTPISMDSAKASTSRPQCPAADSTWMATASPLPPTPSKCVC
QKMALEAGRECRATLPFNWTYTEKAAFLGDLCGKVSCADLGSADDFAMGKYGKYGSCSID
AKTAWALNAYYESQKKDAAACNFGGKAMVVKDGSGAPDDGGAATCVEMIPPEMLGAKADG
GMHDSDGGTGCVGMLARVATLALVVVGTLVSSSVAGVLPLAV

Enzyme Prediction     

EC	2.4.1.-:30

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH72	70	376	5.9e-100	0.9743589743589743

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397351	Glyco_hydro_72	8.33e-119	70	376	10	312	Glucanosyltransferase. This is a family of glycosylphosphatidylinositol-anchored beta(1-3)glucanosyltransferases. The active site residues in the Aspergillus fumigatus example are the two glutamate residues at 160 and 261.
400371	X8	3.13e-15	448	508	18	76	X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains.
197867	X8	1.83e-07	474	511	38	75	Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges.
395098	Cellulase	2.88e-04	122	310	33	237	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS11918.1|CBM43|GH72	2.94e-100	71	510	21	453
BBA60200.1|CBM43|GH72	1.12e-99	70	516	20	454
CAH01682.1|CBM43|GH72	4.17e-99	70	514	33	462
CDR42480.1|CBM43|GH72	1.09e-98	70	516	32	464
QIX00745.1|CBM43|GH72	2.12e-98	71	509	26	463

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W62_A	6.93e-79	70	491	34	456	Saccharomyces cerevisiae Gas2p in complex with laminaripentaose [Saccharomyces cerevisiae],2W63_A Saccharomyces Cerevisiae Gas2p In Complex With Laminaritriose And Laminaritetraose [Saccharomyces cerevisiae],5O9O_A Crystal structure of ScGas2 in complex with compound 7. [Saccharomyces cerevisiae S288C],5O9P_A Crystal structure of Gas2 in complex with compound 10 [Saccharomyces cerevisiae S288C],5O9Q_A Crystal structure of ScGas2 in complex with compound 6 [Saccharomyces cerevisiae S288C],5O9R_A Crystal structure of ScGas2 in complex with compound 9 [Saccharomyces cerevisiae S288C],5O9Y_A Crystal structure of ScGas2 in complex with compound 11 [Saccharomyces cerevisiae S288C],5OA2_A Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_B Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_C Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA6_A Crystal structure of ScGas2 in complex with compound 12 [Saccharomyces cerevisiae S288C]
2W61_A	1.90e-78	70	491	34	456	Saccharomyces cerevisiae Gas2p apostructure (E176Q mutant) [Saccharomyces cerevisiae]
5FIH_A	1.90e-78	70	491	34	456	SACCHAROMYCES CEREVISIAE GAS2P (E176Q MUTANT) IN COMPLEX WITH LAMINARITETRAOSE AND LAMINARIPENTAOSE [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P56092|EPD1_CANMA	3.30e-92	70	509	26	452	Protein EPD1 OS=Candida maltosa OX=5479 GN=EPD1 PE=3 SV=1
sp|P22146|GAS1_YEAST	9.89e-90	70	509	26	453	1,3-beta-glucanosyltransferase GAS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAS1 PE=1 SV=2
sp|P0C955|GEL3_ASPFU	7.17e-89	73	509	17	451	1,3-beta-glucanosyltransferase gel3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gel3 PE=3 SV=1
sp|B0XT09|GEL3_ASPFC	7.76e-89	73	509	17	451	1,3-beta-glucanosyltransferase gel3 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=gel3 PE=1 SV=1
sp|Q9P378|GAS1_SCHPO	2.03e-87	71	514	23	452	1,3-beta-glucanosyltransferase gas1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gas1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.315524	0.684464	CS pos: 49-50. Pr: 0.5001

TMHMM  Annotations     

Start	End
21	43
558	580